KEGG   Escherichia coli clone D i14: i14_3110
Entry
i14_3110          CDS       T02003                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
elc  Escherichia coli clone D i14
Pathway
elc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    i14_3110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elc02044]
    i14_3110
Secretion system [BR:elc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   i14_3110
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AER90572
Position
3115010..3115675
AA seq 221 aa
MKKETDINIDALLRDTFLTVVELRQGTTVRHGMELYRHCQRQVELVRERLKDAGFSRENV
EHITYAQCALLDETVLSRSGMDDGQTIWMKDPLQSHFFNTLQAGELLYERMKQVLQEPAP
AQAVLTCFHRVLLLGFRGRYQDPAAPERDQLISTLNGQVAPFGVLPETAVLNVPLSTRQH
PLLHSPFFWLVTLALLLAGVWWGLHHWLNVLVDELLPQSLR
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaaaaaagagacggatatcaatatcgacgcgctgctgcgcgacacgtttctgacggtg
gtggaactgcgtcagggaaccaccgtgcgtcacggtatggagctgtatcgccactgccag
cggcaggtggaactggtccgcgaacgtctgaaagatgccggattcagtcgggagaacgtg
gagcacataacttacgcgcagtgcgccctgctggacgaaacggtcctgagccgtagcggc
atggacgacggtcagaccatctggatgaaggatccactccagtcgcatttcttcaacacc
ctgcaggccggtgagctgctgtacgagcggatgaagcaggtgctacaggaacccgccccc
gcgcaggccgtgctgacctgctttcaccgtgtcctgctgctgggatttcgcgggcgttat
caggatccggcagccccggagcgcgaccagcttatttcgacgctcaacgggcaggtcgcg
ccatttggtgtgctgccggaaacggcggtactgaacgtgccgttatccacccgtcagcac
cctttgctgcattcgccatttttctggctggtaacactggcgctgctactggcgggcgtc
tggtgggggctacaccactggctgaatgtactggtggatgaactgctgccgcaaagcctg
cgttaa

DBGET integrated database retrieval system