KEGG   Escherichia coli clone D i14: i14_3123
Entry
i14_3123          CDS       T02003                                 

Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
elc  Escherichia coli clone D i14
Pathway
elc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    i14_3123
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elc02044]
    i14_3123
Secretion system [BR:elc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   i14_3123
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AER90585
Position
3135484..3136020
AA seq 178 aa
MFPIRFKRPALLCMAMLTVVLSGCGLIQKVVDESKSVASAVFYKQIKILHLDFFSRSALN
TDAEDTPLSTMVHVWQLKTREDFDKADYDTLFMQEEKTLEKDVLAKHTVWVKPEGTASLN
VPLDKETQFVAIIGQFYHPDEKSDSWRLVIKRDELEADKPRSIELMRSDLRLLPLKDK
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtttcctattcgttttaaacgtccggcgttgctctgtatggcgatgctgacggttgtt
ctgagtggctgcggcctgattcagaaagtggtggatgaatcgaaaagcgtggcctcagcc
gttttctacaaacaaatcaaaatactgcatctcgatttcttctcccgcagcgccctgaat
acggatgcggaagatacgccgctttccacgatggtgcatgtctggcaactgaaaacccgc
gaagattttgacaaggcggattacgacaccctgtttatgcaggaagagaagacgctggag
aaggacgtactggcaaaacacaccgtctgggtaaaaccggaaggcacggcatccctgaat
gtgccgctggataaagagacgcagtttgtcgccattattgggcagttttatcaccctgat
gaaaaaagcgacagctggcgtctggtgatcaaaagggacgaactggaggccgacaagccg
cgctcgattgaactgatgagaagcgacctgcgactgctgcctctcaaggataaataa

DBGET integrated database retrieval system