KEGG   Escherichia coli clone D i14: i14_4521Help
Entry
i14_4521          CDS       T02003                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
elc  Escherichia coli clone D i14
Pathway
elc00471  D-Glutamine and D-glutamate metabolism
elc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    i14_4521 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:elc01011]
    i14_4521 (murI)
Enzymes [BR:elc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     i14_4521 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:elc01011]
 Precursor biosynthesis
  Racemase
   i14_4521 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF1847
Motif
Other DBs
NCBI-ProteinID: AER91958
Structure
PDB: 

Position
4519664..4520521
Genome map
AA seq 285 aa AA seqDB search
MATKLQDGNIPCLAATPSEPRPTVLVFDSGVGGLSVYDEIRHLLPDLHYIYAFDNVAFPY
GEKSEVFIVERVVEIVTAVQERYPLALAVVACNTASTVSLPALREKFDFPVVGVVPAIKP
AARLTANGIVGLLATRGTVKRSYTHELIARFANECQIEMLGSAEMVELAEAKLHGEDVSL
DALKRILRPWLRMKEPPDTVVLGCTHFPLLQEELLQVLPEGTRLVDSGAAIARRTAWLLE
HEAPDAKSADANIAFCMAMTPEAEQLLPVLQRYGFETLEKLAVLD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaaactgcaggacgggaatataccttgtctggcagctacaccttctgaacca
cgtcccaccgtgctggtgtttgactccggcgtcggtgggttgtcggtctatgacgagatc
cggcatctcttgccggatctccattacatttatgctttcgataacgtcgctttcccgtat
ggcgaaaaaagcgaagtgtttattgttgagcgagtggtggaaattgtcaccgcagtgcaa
gaacgttatccccttgcgctggctgtggtcgcttgcaacaccgccagtaccgtttcactt
cctgcattacgcgaaaagttcgacttcccggttgttggtgtcgtgccggcgattaaacct
gctgcacgtctgacggcaaatggcattgtcggattactggcaacccgcggaactgttaaa
cgttcttatactcatgagctgatcgcgcgtttcgctaatgaatgccagatagaaatgctg
ggctcggcagagatggttgagttggctgaagcgaagctgcatggcgaagatgtttctctg
gatgcgctaaaacgtatcctacgcccgtggttaagaatgaaagagccgccagatacagtt
gtattgggttgcacccatttccctctactacaagaagaactattacaagtgctgccagag
ggaacccggctggtggattctggcgcagcgattgctcgccgaacggcctggttgttagag
catgaagccccggatgcaaaatctgccgatgcgaatattgcattttgtatggcaatgacg
ccagaagctgaacaattattgcccgttttacagcgttacggcttcgaaacgctcgaaaaa
ctggcagttttagattga

DBGET integrated database retrieval system