KEGG   Escherichia coli clone D i2: i02_1831Help
Entry
i02_1831          CDS       T02004                                 

Gene name
hdhA
Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
eld  Escherichia coli clone D i2
Pathway
eld00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:eld00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    i02_1831 (hdhA)
Enzymes [BR:eld01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     i02_1831 (hdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AER84401
Structure
PDB: 

Position
complement(1800240..1801007)
Genome map
AA seq 255 aa AA seqDB search
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVNEIQQLGG
QAFACRCDITSEQELSALADFAVSKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVF
SFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEK
NIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVS
GQILTVSGGGVQELN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaattctgacaacctgagactcgacggaaaatgcgccatcatcacaggtgcgggt
gcaggtattggtaaagaaatcgccattacattcgcgacagctggcgcatctgtggtggtc
agtgatattaacgccgatgcagctaatcatgttgtaaatgaaattcaacaactgggtggt
caggcatttgcctgccgctgcgatattacttccgaacaggaactctctgcactggcagac
tttgccgtcagtaagttgggtaaagttgatatcctggttaacaacgccggtggcggtggg
cctaaaccgtttgatatgccaatggcagattttcgccgcgcttatgaactgaatgtattt
tcttttttccatctgtcacaacttgttgcgccagaaatggaaaaaaatggcggtggcgtt
attctgaccattacttctatggcggcagaaaataaaaatataaacatgacctcctatgca
tcatctaaagctgcggccagtcatctggtcagaaatatggcgtttgacctgggtgaaaaa
aatattcgggtgaatggcattgcaccgggggcaatattaaccgatgccctgaaatccgtt
attacaccagagattgaacagaaaatgttgcaacacacaccaatcagacgtctgggccaa
ccgcaagatattgctaacgcggcgctgttcctttgctcgcctgcagccagctgggtaagc
ggacaaattctcaccgtctccggtggtggggtacaggaactcaattaa

DBGET integrated database retrieval system