KEGG   Escherichia coli clone D i2: i02_2795Help
Entry
i02_2795          CDS       T02004                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
eld  Escherichia coli clone D i2
Pathway
eld00300  Lysine biosynthesis
eld01100  Metabolic pathways
eld01120  Microbial metabolism in diverse environments
eld01230  Biosynthesis of amino acids
Module
eld_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:eld00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    i02_2795 (dapE)
Enzymes [BR:eld01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     i02_2795 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AER85344
Position
2799447..2800574
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQNFWAWRGQGET
LAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPN
HTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFINELVAIEWDQGNEFFPATSMQIANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacaacagcttattcgccgcccttccctgagtcct
gatgacgcaggatgccaggctttgttgattgaacgtttgcaggcgatcggttttaccgtt
gaacgcatggactttgccgacacgcagaatttttgggcatggcgtgggcagggtgaaacg
ttagcctttgccgggcataccgacgtggtgccgcctggcgacgccgaccgttggatcaat
ccgccgtttgaaccaaccattcgtgacggcatgttattcgggcgcggtgcggcagatatg
aaaggctcgctggcggcgatggtggtagctgcagaacgttttgtcgcacaacatcccaac
catacggggcgactggcatttctgatcacctctgatgaagaagccagtgcacacaatggt
acggtaaaagtcgtcgaagcgttaatggcacgtaatgagcgtctcgattactgcctggtt
ggcgaaccgtcgagtatcgaagtggtaggtgatgtggtgaaaaatggtcgtcgcggatcg
ttaacctgcaaccttaccattcatggcgttcaggggcatgttgcctacccacatctggct
gacaatccggtacatcgcgcagcacctttcattaatgaattagtggctattgagtgggat
cagggtaatgaattcttcccggcgaccagtatgcagattgccaatattcaggcgggaacg
ggcagtaacaacgttattccaggtgaactgtttgtgcagtttaacttccgctttagcacc
gaactgacggatgagatgatcaaagcgcaggtgcttgccctgcttgaaaaacatcaactg
cgctatacggtggattggtggctttccgggcagccatttttgaccgcgcgcggtaaactg
gtggatgcggtcgttaacgcggttgagcactataatgaaattaaaccgcagctactgacc
acaggcggaacgtccgacgggcgctttattgcccgcatgggggcgcaggtggtggaactc
gggccggtcaatgccacgattcataaaattaatgaatgtgtgaacgctgccgacctgcag
ctacttgcccgtatgtatcaacgtatcatggaacagctcgtcgcctga

DBGET integrated database retrieval system