KEGG   Escherichia coli clone D i2: i02_3074Help
Entry
i02_3074          CDS       T02004                                 

Gene name
barA
Definition
(GenBank) hybrid sensory histidine kinase BarA
  KO
K07678  two-component system, NarL family, sensor histidine kinase BarA [EC:2.7.13.3]
Organism
eld  Escherichia coli clone D i2
Pathway
eld02020  Two-component system
eld02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:eld00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    i02_3074 (barA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    i02_3074 (barA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eld01001]
    i02_3074 (barA)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eld02022]
    i02_3074 (barA)
Enzymes [BR:eld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     i02_3074 (barA)
Protein kinases [BR:eld01001]
 Histidine kinases
  NarL family
   i02_3074 (barA)
Two-component system [BR:eld02022]
 NarL family
  BarA-UvrY (central carbon metabolism)
   i02_3074 (barA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2222 HATPase_c Response_reg HisKA Hpt HAMP HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AER85617
Structure
PDB: 

Position
3078412..3081168
Genome map
AA seq 918 aa AA seqDB search
MTNYSLRARMMILILAPTVLIGLLLSIFFVVHRYNDLQRQLEDAGASIIEPLAVSTEYGM
SLQNRESIGQLISVLHRRHSDIVRAISVYDENNRLFVTSNFHLDPSSMQLGSNVPFPRQL
TVTRDGDIMILRTPIISESYSPDESPSSDAKNSQNMLGYIALELDLKSVRLQQYKEIFIS
SVMMLFCIGIALIFGWRLMRDVTGPIRNMVNTVDRIRRGQLDSRVEGFMLGELDMLKNGI
NSMAMSLAAYHEEMQHNIDQATSDLRETLEQMEIQNVELDLAKKRAQEAARIKSEFLANM
SHELRTPLNGVIGFTRLTLKTELTPTQRDHLNTIERSANNLLAIINDVLDFSKLEAGKLI
LESIPFPLRSTLDEVVTLLAHSSHDKGLELTLNIKSDVPDNVIGDPLRLQQIITNLVGNA
IKFTENGNIDILVEKRALSNTKVQIEVQIRDTGIGIPERDQSRLFQAFRQADASISRRHG
GTGLGLVITQKLVNEMGGDISFHSQPNRGSTFWFHINLDLNPNIIIEGPSTQCLAGKRLA
YVEPNSAAAQCTLDILSETPLEVVYSPTFSALPPAHYDMMLLGIAVTFREPLTMQHERLA
KAVSMTDFLMLALPCHAQVNAEKLKQDGIGACLLKPLTPTRLLPALTEFCHHKQNTLLPV
TDESKLAMTVMAVDDNPANLKLIGALLEDMVQHVELCDSGHQAVERAKQMPFDLILMDIQ
MPDMDGIRACELIHQLPHQQQTPVIAVTAHAMAGQKEKLLGAGMSDYLAKPIEEERLHNL
LLRYKPGSGISSRVVTPEVNEIVVNPNATLDWQLALRQAAGKTDLARDMLQMLLDFLPEV
RNKVEEQLVGENPEGLVDLIHKLHGSCGYSGVPRMKNLCQLIEQQLRSGTKEEDLEPELL
ELLDEMDNVAREASKILG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgaccaactacagcctgcgcgcacgcatgatgattctgatcctggcaccgaccgtcctt
attggtttattgctgagtatctttttcgtcgtgcatcgctataacgacttgcagcgtcaa
ctggaagatgccggtgccagcattattgagccgcttgcagtttctactgaatatggcatg
agtctgcaaaatcgcgaatctatcggtcagttaataagcgtactgcatcgtcgccattct
gatattgttcgcgcgatttcggtttatgatgaaaataaccgactctttgtcacctccaat
tttcatcttgatccctcatcaatgcagctcggcagcaacgtgccgtttcctcgccagctc
actgtcactcgtgacggcgatataatgatcctccgcacgccgattatttctgaaagttac
tcccccgacgaatcgcccagtagcgatgccaaaaatagtcaaaatatgctgggatatatt
gcgctggagctggatcttaaatcggttcgcttgcagcaatataaagagatctttatttcc
agcgtgatgatgctgttttgtatcggtattgcgcttatttttggctggcgcttaatgcgc
gatgtaaccggtccgattcgcaacatggtgaataccgtcgaccgcatccgtcgcgggcaa
ctcgacagccgggtggaaggatttatgctcggcgagctggatatgctgaaaaacggtatc
aactcgatggcaatgtcgctggcggcttatcacgaagagatgcaacacaatatcgaccag
gcgacgtccgatctgcgtgagacgctggagcaaatggagattcagaacgttgagttggat
ctggcgaaaaagcgcgcccaggaagcggcgcgtattaaatccgagtttctggcaaatatg
tcacacgagctgcgtacaccactgaatggtgttattggctttacccgcctgacgctgaaa
acagaattaacaccaacgcagcgcgatcacctgaatacgattgaacgttcggcaaataat
ttgctggcaattattaatgatgttctcgacttctcgaaactggaagccggtaagctgatt
ctggaaagtattccattcccactacgcagcacgctggatgaagtcgttaccctgctggca
cattcttctcacgataaagggctggaactgacgctcaatattaaaagcgacgtgcctgat
aacgtgatcggcgacccactacgattacagcaaatcatcactaacctggtagggaatgca
attaaattcaccgagaatggcaacattgatattctggtagaaaaacgtgcgctgagtaat
accaaagtgcaaattgaagtgcagattcgggataccggcattggtattcctgaacgcgat
caatcgcgcttattccaggccttcagacaggctgatgccagtatttcccgccgtcatggt
ggcaccgggctggggctggtgattacacaaaaactggttaatgaaatgggcggcgatatt
tcgttccatagccagccgaatcgcggttcaactttctggttccacattaatctcgatctg
aacccgaacattattatcgaagggccatccacccagtgcctcgctggtaagcgcctggcc
tatgtcgaaccaaactccgcagcagcacaatgcacgctggatattttaagtgaaacgccg
ctggaagtggtttatagcccaacgttctccgcgctgcctcccgcgcattacgacatgatg
ttattaggcatagcggtgaccttccgcgagccgctaacaatgcaacatgagcgattagcg
aaagcagtatcgatgaccgatttcctgatgctggcacttccttgccatgcacaagtcaat
gctgaaaaacttaagcaagatggtatcggcgcgtgtctgctgaaaccattaacacctacg
cgcctgttgcctgccctgacagaattttgtcatcacaaacaaaacacgcttttgcctgta
accgatgaaagtaagctggcaatgacagtcatggcggttgatgacaaccccgctaacctg
aaacttatcggcgcattgctggaagatatggtgcaacatgtggaactttgcgatagcggg
catcaggcggttgaacgggcgaaacagatgccgttcgatttaatcttaatggatattcaa
atgccggacatggacggcattcgggcatgtgagctcatccaccagctcccgcatcagcag
caaacgccggttatcgcggtaacggcgcatgcgatggccgggcaaaaagagaaactgctt
ggcgcggggatgagtgattatctggccaaaccgatcgaagaagagcgattgcataatttg
ctgttgcgctacaagcctggcagcggtatttcctctcgcgtcgtgacgcccgaagtcaac
gaaattgtggtcaacccgaatgcgaccctcgactggcaactggcactacgccaggcagca
ggaaaaaccgatttagcgcgcgatatgctgcaaatgttactcgatttcctgcctgaagtt
cgcaacaaagttgaggaacagctggttggagaaaacccggaaggcctggttgatttgatt
cataaactgcatggcagttgcggctatagcggtgtaccgcgtatgaagaatctctgccaa
ctgatcgaacaacagctacgtagcggtactaaagaagaagatttagagccggagctgctg
gaactgttggacgagatggataatgtagcgcgcgaagccagcaaaattctcgggtaa

DBGET integrated database retrieval system