KEGG   Escherichia coli clone D i2: i02_4419Help
Entry
i02_4419          CDS       T02004                                 

Gene name
yihU
Definition
(GenBank) oxidoreductase yihU
  KO
K08318  4-hydroxybutyrate dehydrogenase / sulfolactaldehyde 3-reductase [EC:1.1.1.61 1.1.1.373]
Organism
eld  Escherichia coli clone D i2
Pathway
eld00650  Butanoate metabolism
eld01100  Metabolic pathways
eld01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    i02_4419 (yihU)
Enzymes [BR:eld01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.61  4-hydroxybutyrate dehydrogenase
     i02_4419 (yihU)
    1.1.1.373  sulfolactaldehyde 3-reductase
     i02_4419 (yihU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored 2-Hacid_dh_C 3HCDH_N UDPG_MGDP_dh_N IlvN TrkA_N ApbA
Motif
Other DBs
NCBI-ProteinID: AER86939
Position
4412484..4413563
Genome map
AA seq 359 aa AA seqDB search
MIPTHAILVIFVLSCLILSSLVNLNDTNDQISDACRVFEHKLQICSKTDENEFSIVIILS
MSDRRVFMATIAFLGLGQMGSPMANNLLQKGHSLQVFDVNTQAVDALVTQGATAAQTPAE
AAASAEFIITMLPNGDIVRQVLLGEKGVCETVSSDALVIDMSTIHPLQTDALIRELQEKG
INMMDAPVGRTSVNAIDGTLLILAGGTDEQIARARPILMCMGNELVEAGGPGMGIRVKLI
NNYMSIALNALSSEAAVLCESLGLNLDVAIKVMSGTAAGKGHFTTTWPGKVLKGDLSPAF
MVDLALKDLRIAVDVARKTGAPLNMGIAAESYYAAASQDGKGRQDWSALLNQVRQQAGL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgatacccacgcatgcaattctggtcatatttgtcttgtcctgtttaattttgtcgtct
ttggtcaatttaaatgacacaaatgatcaaattagtgatgcgtgtcgtgtttttgaacat
aaattacaaatatgctcaaaaacagacgaaaacgaattttcaattgtcattattttgtca
atgtcagacaggagagtattcatggcaaccattgcatttctcgggctggggcagatgggt
agcccaatggctaacaatctattgcaaaaagggcattcattacaggtatttgatgtcaat
acacaggccgtcgatgcgctagttacgcagggggccactgcggcacaaaccccagcggaa
gcggcagcaagcgctgaatttatcatcactatgcttcccaatggggacattgttcgacag
gtgctgttgggggaaaaaggcgtctgtgaaactgtttcatctgacgcgttagtgattgat
atgtcgactattcatcccttacagaccgatgcattaatacgggaattacaagaaaaaggc
atcaatatgatggacgcccccgtgggcagaacgtcagtgaatgcgattgatggcacattg
ctgattttagcgggcggcactgatgagcagattgcgcgtgcacgcccgattctcatgtgc
atgggtaatgagctggtcgaggctggtggcccaggaatggggatccgcgtgaagctaatt
aacaactatatgagcattgcgcttaatgcgctgtcctccgaagccgctgtgttatgtgag
tcactgggattaaatcttgatgtcgcaattaaggtgatgagtggtacggcagcagggaaa
ggacattttacgaccacctggcctggcaaagtgctgaaaggcgatctttctcccgccttc
atggtggacctggcattgaaagatctgcgtattgcagttgacgtcgctcggaaaacgggg
gcgccgctcaatatggggattgcagcagaaagttattacgccgcagcaagtcaagacggc
aaagggcggcaggactggagcgccctgctaaatcaggttcgccagcaggctggtctttaa

DBGET integrated database retrieval system