KEGG   Escherichia coli clone D i2: i02_4457Help
Entry
i02_4457          CDS       T02004                                 

Gene name
cpxA
Definition
(GenBank) two-component sensor protein
  KO
K07640  two-component system, OmpR family, sensor histidine kinase CpxA [EC:2.7.13.3]
Organism
eld  Escherichia coli clone D i2
Pathway
eld01503  Cationic antimicrobial peptide (CAMP) resistance
eld02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eld00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    i02_4457 (cpxA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    i02_4457 (cpxA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eld01001]
    i02_4457 (cpxA)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eld02022]
    i02_4457 (cpxA)
Enzymes [BR:eld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     i02_4457 (cpxA)
Protein kinases [BR:eld01001]
 Histidine kinases
  OmpR family
   i02_4457 (cpxA)
Two-component system [BR:eld02022]
 OmpR family
  CpxA-CpxR (envelope stress response)
   i02_4457 (cpxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA CpxA_peri HAMP HATPase_c_3 HATPase_c_2 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AER86975
Structure
PDB: 

Position
complement(4445092..4446465)
Genome map
AA seq 457 aa AA seqDB search
MIGSLTARIFAIFWLTLALVLMLVLMLPKLDSRQMTELLDSEQRQGLMIEQHVEAELAND
PPNDLMWWRRLFRAIDKWAPPGQRLLLVTTEGRVIGAERSEMQIIRNFIGQADNADHPQK
KKYGRVELVGPFSVRDGEDNYQLYLIRPASSSQSDFINLLFDRPLLLLIVTMLVSTPLLL
WLAWSLAKPARKLKNAADEVAQGNLRQHPELEAGPQEFLAAGASFNQMVTALERMMTSQQ
RLLSDISHELRTPLTRLQLGTALLRRRSGESKELERIETEAQRLDSMINDLLVMSRNQQK
NALVSETIKANQLWSEVLDNAAFEAEQMGKSLTVNFPPGPWPLYGNPNALESALENIVRN
ALRYSHTKIEVGFAVDKDGITITVDDDGPGVSPEDREQIFRPFYRTDEARDRESGGTGLG
LAIVETAIQQHRGWVKAEDSPLGGLRLVIWLPLYKRS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgataggcagcttaaccgcgcgcatcttcgccatcttctggctgacgctggcgctggtg
ttgatgttggttttgatgttacccaagctcgattcacgccagatgaccgagcttctggat
agcgaacagcgtcagggtctgatgattgagcagcatgtcgaagcggagctggcgaacgat
ccgcccaacgatttaatgtggtggcggcgtctgttccgggcgattgataagtgggcaccg
ccaggacagcgtttgttattggtgaccaccgaaggccgcgtgatcggcgctgaacgcagc
gaaatgcagatcattcgtaactttattggtcaggccgataacgccgatcatccgcagaag
aaaaagtatggccgcgtggaactggtcggtccgttctccgtgcgtgatggcgaagataat
taccaactttatctgattcgtccggccagcagttctcaatccgatttcataaacttactg
tttgaccgcccgctattactgctgattgtcaccatgctggtcagtacgccgctgctgttg
tggttggcctggagtctggcaaaaccggcgcgtaagctgaaaaacgctgccgatgaagtt
gcccagggaaacttacgccagcacccggaactggaagcggggccacaggaattccttgcc
gccggtgccagttttaaccagatggtcaccgcgctggagcgcatgatgacctctcagcag
cgtctactttctgatatctctcacgaactgcgcaccccgctgacgcgtctgcaactgggt
acggcgttactgcgccgtcgtagcggtgaaagcaaggaactggagcgtattgaaactgaa
gcgcaacgtctggacagcatgatcaacgatctgttggtgatgtcacgtaatcagcagaaa
aatgcgctggttagcgagaccatcaaagccaaccagttgtggagtgaagtgctggataac
gcggcgttcgaagccgagcaaatgggcaagtcgttgacggttaacttcccacctgggccg
tggccgctgtacggcaacccgaacgccctggaaagtgcgctggaaaacattgttcgtaat
gctctgcgttattcccatacgaagattgaagtgggctttgcggtagataaagacggtatc
accattacggtggacgacgatggtcctggcgttagcccggaagatcgcgaacagattttc
cgtccgttctatcggaccgacgaagcacgcgatcgtgaatctggcggtacaggtttgggg
ctggcgattgttgaaaccgccattcagcagcatcgtggctgggtgaaggcagaagacagc
ccgctgggcggtttacggctggtgatttggttgccgctgtataagcggagttaa

DBGET integrated database retrieval system