KEGG   Escherichia coli clone D i2: i02_4491Help
Entry
i02_4491          CDS       T02004                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
eld  Escherichia coli clone D i2
Pathway
eld00670  One carbon pool by folate
eld01100  Metabolic pathways
eld01120  Microbial metabolism in diverse environments
eld01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eld00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    i02_4491 (metF)
Enzymes [BR:eld01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     i02_4491 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AER87009
Structure
PDB: 

Position
4481459..4482349
Genome map
AA seq 296 aa AA seqDB search
MSFFHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTY
GANSGERDRTHSIIKGIKDRTGLEAAPHLTCIDATPAELRIIARDYWNNGIRHIVALRGD
LPPGSGKPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLRRKVDAGANRA
ITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFD
GLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPGL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttttcacgccagccagcgggatgccctgaatcagagtctggcagaagtccag
gggcagattaacgtttcgttcgaatttttcccgccgcgtaccagtgaaatggagcagacc
ctgtggaactccatcgatcgccttagcagcctgaaaccgaagtttgtatcggtgacctat
ggcgcaaactccggcgagcgcgaccgtacgcacagcattattaaaggcattaaagatcgc
accggcctggaagcggcaccgcatcttacctgcattgatgcgacgcctgccgagctgcgg
atcattgcacgcgactactggaataacggtattcgccatatcgtggcgctgcgtggcgac
ctgccgccgggaagtggtaagccagaaatgtatgcttctgacctggtgacgctgttaaaa
gaagtggcagatttcgatatctccgtggcggcgtatccggaagtacatccagaagcgaaa
agtgcccaggccgatttactcaacctgagacgaaaagtggatgccggagccaaccgcgcc
attactcagttcttcttcgatgtcgaaagctacctgcgttttcgcgatcgctgcgtctcg
gcaggcattgatgtggaaatcattccgggaattttgccggtttcgaactttaaacaggcg
aagaaatttgccgacatgaccaacgtgcgtattccggcgtggatggcacaaatgttcgac
ggcctggatgacgatgctgaaacccgcaagctggtgggcgcgaatattgccatggatatg
gtgaagattttaagccgtgaaggagtgaaagatttccacttctatacgcttaaccgcgct
gaaatgagttacgcgatttgccatacactgggagttcgacctggtttataa

DBGET integrated database retrieval system