KEGG   Eggerthella lenta: Elen_0089Help
Entry
Elen_0089         CDS       T00984                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ele  Eggerthella lenta
Pathway
ele00900  Terpenoid backbone biosynthesis
ele01100  Metabolic pathways
ele01110  Biosynthesis of secondary metabolites
ele01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Elen_0089
Enzymes [BR:ele01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Elen_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACV54083
UniProt: C8WJ81
Position
118023..119024
Genome map
AA seq 333 aa AA seqDB search
MTQPSKNGENAVDMLAVARIAQGVDIAGFAGPDAVKLVAPAKVNLFLDIGAKRADGYHEA
VSIMHALMLHDVLRMKLAPGRGEGLSVDLSCVAREGLAMLDVPVESNIVAKAVRLLAEKL
GRTADETVVACLEKHIPAEAGLGGGSSDAAAALLGAAHLWGVPADDPRIEEAARSLGADV
AFFLHGGCACFTGVGDAFDHALAPMNGNVVLVKPEGGVSTAAAYRAFDEHPTAISEADRE
AALEAQRAADVPLRNNLVPVSEHLLPALVDIRLWASERADVQRVLMSGSGSAVFMQCATF
ADAGRVAAEARMRGWWARATMFGSARAAVVPNR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccgagcaagaacggcgaaaacgccgtagacatgctggccgtggctcgcatc
gcgcagggcgtggacatcgcgggcttcgccggccccgatgccgtcaagctggtggcaccg
gcgaaagtgaatctgttcctcgacatcggcgcgaagcgcgcggacggctatcacgaggcc
gtcagcatcatgcatgcgctcatgctgcacgacgttttacgcatgaagctggcgccggga
cgcggagaaggtctatccgtcgatctctcgtgcgttgcgcgcgaagggctcgcgatgctc
gatgtgcccgtggagagcaacatcgtggcgaaggccgtgcgcttgctggctgaaaaattg
ggacgcacggctgacgagacggtggtcgcctgcctcgagaagcacatccccgccgaggcc
ggtttgggcggcggctcctccgacgccgccgcggcgctgctgggcgctgcgcacttgtgg
ggcgtgcctgccgacgatccgcgtatcgaggaagcagcacgaagcctgggtgccgacgtg
gcgttcttcctgcatggcggctgcgcttgcttcacgggcgtgggcgatgcgttcgaccat
gcccttgcgcccatgaacggcaacgtcgtgctcgtgaagcccgagggcggcgtgtccacg
gctgccgcgtaccgcgcgttcgacgagcatcccacggccatttccgaggccgatcgcgaa
gcagccctcgaagcccagcgcgccgccgacgtgccgctgcgcaacaacctcgtgcccgtt
tccgagcacctgcttccggcgctcgtggacatccgcttgtgggctagcgagcgcgccgac
gtgcagcgcgtgctcatgtcgggcagcgggtcggccgtgttcatgcagtgcgccacgttc
gccgatgcaggtcgcgtggccgccgaggcgcgcatgcgcggctggtgggcgcgtgctacc
atgtttggctcggcgcgtgcggccgtggtgccgaaccgctga

DBGET integrated database retrieval system