KEGG   Eggerthella lenta: Elen_0198Help
Entry
Elen_0198         CDS       T00984                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K22606  3beta-hydroxycholanate 3-dehydrogenase (NAD+) [EC:1.1.1.391]
Organism
ele  Eggerthella lenta
Pathway
ele00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ele00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    Elen_0198
Enzymes [BR:ele01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.391  3beta-hydroxycholanate 3-dehydrogenase (NAD+)
     Elen_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 2-Hacid_dh_C Epimerase THF_DHG_CYH_C ApeA_NTD1 LytR_C
Motif
Other DBs
NCBI-ProteinID: ACV54192
UniProt: C8WJW0
Position
278756..279541
Genome map
AA seq 261 aa AA seqDB search
MYDDLKGKTVVVTGSSKGLGAAMARRFGAEGMNVVANYRSDEEGARETVRAIEEAGGAAA
AVQADVSKNECVDALFDAAMFSFGGVDIWVNNAGIEVASPSDRKSIEEWQRVIDVNLTGV
FAGCRRAIDHFLDRKMPGVIINLSSVHEIIPWPHFADYAASKAGVGMLTKTLALEYADRG
IRVNAIAPGAMNTPINAEKFADPEARAATERLIPMGYVGAPEDVAAAAAWLASDQASYVT
GTTLFVDGGMTLYPGFQFGQG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgatctcaagggcaagacggtggtggtgacgggcagctcgaaggggctgggc
gccgccatggcgcggcgcttcggcgccgagggcatgaacgtggtggcgaactaccgctcc
gacgaagagggcgcgcgcgaaacggtgcgagccatcgaggaagcgggcggagcggcggcc
gcggtgcaggccgacgtgagcaagaacgagtgcgtggacgccctgttcgacgctgcgatg
ttctcgttcggcggcgtggacatctgggtgaacaacgcgggcatcgaggtggcttcgccg
tccgatcggaagtccatcgaggaatggcagcgcgtcatcgacgtgaacctgaccggcgtg
ttcgcgggctgccgccgcgccatcgatcactttctggatcgcaagatgcccggcgtcatc
atcaacctgtcgtcggtgcacgagatcattccgtggccgcatttcgccgactatgcggcc
agcaaggcaggagtcggcatgctgacgaagacgctggcgctcgagtacgccgaccgcggc
atccgcgtgaacgccatcgcgcccggagccatgaacacgcccatcaacgcggagaagttc
gccgatcccgaagcgcgcgccgcaaccgaacggctcatcccgatggggtacgtgggcgcc
cccgaagacgtggccgccgccgcggcctggctcgcgtccgaccaggccagctacgtgacc
ggcaccaccctgttcgtcgacggcggcatgacgctgtaccccggcttccagttcgggcag
ggctag

DBGET integrated database retrieval system