KEGG   Eggerthella lenta: Elen_2469Help
Entry
Elen_2469         CDS       T00984                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ele  Eggerthella lenta
Pathway
ele00900  Terpenoid backbone biosynthesis
ele01100  Metabolic pathways
ele01110  Biosynthesis of secondary metabolites
ele01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Elen_2469
Enzymes [BR:ele01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Elen_2469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACV56425
UniProt: C8WL46
Position
complement(2891755..2893002)
Genome map
AA seq 415 aa AA seqDB search
MKRIVVLGSTGSIGAQTLDVVRRHADKLEVVGLAVGTRVGELLAQAREFGVRHLAVGDER
LAEQPIADELRNAILSGSHGGTQQPASAPSSLAEAVARHNAGGEGSLGFGADAVVDLVRL
PEADIVVNALVGAAGLRASYETLAAGKVLALANKESLVVGGDLIMPMAAEPGRLMPIDSE
HGAIYQCLLGEDPREVSRLWVTASGGPFRGRTRADLADITPAQALAHPTWNMGAKISIDS
STLMNKGLEVIEAHHLFAMSYDRISVVVQPQSAIHSMVEYSDGSVKAHLGTTDMRIPIQF
ALSYPERWDAPVEPLDFTKLGTLEFAAPDTDTFRCLALARAAGERGGTLPCVMNAANEVA
VAAFLAEEGSYLGIAACVEAVMDAHERQGVQRVESLDQLEELDAWARAEARRNVR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatagtggtcttgggctccacgggctccatcggcgcgcagacgctggacgtt
gtgcgtcgccatgcggacaagctggaggtggtgggcctcgccgtgggcacgcgcgtgggc
gagctgctggcgcaagcgcgcgagttcggcgtgcgccacctcgcggtgggcgacgagcgc
ctggctgagcagccgattgccgacgagctgcgaaacgccatcctgagcggatcgcacgga
ggcacgcagcagccagcgagcgcgccgtcgtcgctggccgaggccgtggcgcgtcacaac
gcgggcggcgaagggtcgctcgggttcggtgccgacgccgtggtggacctcgtgcgcctg
cccgaggccgacatcgtggtgaacgcgctggtgggcgcggccggcctgcgcgccagctac
gagacgctcgcagctggcaaggtgctggcgctcgcgaacaaggagtcgctcgtggtgggc
ggcgacctcatcatgccgatggccgccgagccggggcgcctcatgcccatcgattccgag
cacggcgccatctaccagtgccttctgggcgaagacccgcgcgaggtgtcgcgcttgtgg
gtgacggcgtcgggcggaccgttccgcggccgcacgcgagccgacctggccgatatcacg
cccgctcaggcgctcgcgcaccccacgtggaacatgggcgcgaagatatccatcgactcg
tccacgctgatgaacaagggtctcgaggtcatcgaggcgcaccacctgttcgccatgtcc
tacgatcgcatcagcgtggtcgtgcagccgcagagcgccatccactccatggtggagtac
tcggacggcagcgtgaaggcccatctgggcaccaccgacatgcgcatccccattcagttc
gcgctgtcgtaccctgagcgctgggacgcgccggtcgagccgctcgacttcacgaagctg
ggtaccctcgaattcgccgctcccgacaccgacacgttccgttgcctggcgctggctcgc
gcggccggcgagcgcggcggcacgctgccctgcgtgatgaacgccgcgaacgaggtggcc
gtcgccgccttcctcgctgaagagggcagctacctggggatcgccgcgtgcgtcgaggcc
gtcatggacgcccacgagcgccaaggcgtccaacgcgtggaaagcctcgaccagctggaa
gagctcgacgcttgggcgcgagcggaagcgcgcaggaacgtgcgctag

DBGET integrated database retrieval system