KEGG   Eggerthella lenta: Elen_2542Help
Entry
Elen_2542         CDS       T00984                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxyl carrier protein
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
ele  Eggerthella lenta
Pathway
ele00620  Pyruvate metabolism
ele01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ele00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Elen_2542
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ele02000]
    Elen_2542
Enzymes [BR:ele01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Elen_2542
Transporters [BR:ele02000]
 Other transporters
  Primary active transporters [TC:3]
   Elen_2542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ACV56497
UniProt: C8WLN4
Position
complement(2974093..2975982)
Genome map
AA seq 629 aa AA seqDB search
MPRLQIMDTTIRDGQQSLWATRMQIGDMLPILPKMDRVGYWAIEAWGGATFDTCMRFLDE
NPWERLRSIKAQTPNTPLSMLSRGQNLVGYKHYSRDICNHFIKAAKRNGVHVFRVFDALN
DIRNVVDNAEAIKECGGHFEGAISYTMSPVHTLDSFLDYGQKLKDLGADSICIKDMAGML
TPYRTERMVKAFNAEIGLPLHIHCHYVGGMAPANILKAAEAGAAIADTAHAPLAFGNSHP
AVEMIVAALQESRYDTGLDLDLLFEIAEYWEGVRKRGHYKRGVSSLTHMQVYSHQVPGGM
MSNLVSQLEIQNAADRLPEVMKEIPKVRAEVGYPPLVTPMSQIVGTQAVFNVLTGKRWSV
VSKEMKDYICGYYGKAPGRMDKDIVAKVVGNSEMLPPDVAPGSLVTTTYAQVEEEIGDLA
KSEEDVLMYALFPNEARTFLSKHRTSEKVDFLMEQESSHTKEDDYVDINQIRELVRVAEE
SGVGEIVVEEEGTRIAVRMPGTLSSEAAAAAAAAPVAAVAPAPAAAAPAAAADDVERPSD
WYAVTAPMVGTFYASPAPGEPPFVQVGDEVAANQTLCIVEAMKLMNEIAAEEMGTVREVC
LEDASPVEFGTVLFYVEPHGAPAPAPETA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggcttcagatcatggataccaccatccgtgacggccagcaaagcctctgggcc
acgcgcatgcagatcggcgatatgctgccgatcctgcctaaaatggaccgtgtcgggtac
tgggccatcgaggcgtggggcggtgcgacgtttgacacgtgcatgcgcttcctcgacgag
aacccgtgggagcgactgcgatctatcaaggcgcagacgccgaacacgccgctctcgatg
ctgtcccgcggtcagaacttggtggggtacaagcactattcgcgcgacatctgcaatcat
ttcatcaaggccgcgaagcgcaatggcgtgcatgtcttccgcgtgttcgacgcgctcaac
gacatccgcaacgtcgtcgacaacgccgaagccatcaaggaatgcggcggccacttcgaa
ggagccatctcctacacgatgtcgccggtccacacgctcgacagcttcctcgactacggt
cagaagctcaaggacctcggtgccgactccatctgcatcaaggacatggcgggcatgctc
acgccgtaccgcaccgagcgcatggtgaaggccttcaatgccgaaatcggtttgccgctg
cacatccattgccactacgtcggcggcatggctcccgccaacatcctcaaggccgccgaa
gccggcgccgccatcgccgacacggcccatgcgccgctggcgttcggcaactcgcacccg
gccgtcgagatgatcgtcgccgcgctccaggagagccgttacgacaccggcctcgacctc
gatctcttgttcgagatcgccgagtactgggaaggcgtgcgcaagcgcggccactacaag
cgcggcgtctcgtcgctcacgcacatgcaggtgtactcgcaccaggtgccgggcggcatg
atgtcgaacctcgtgtcgcagctggaaatccagaacgcggccgaccgcctgcccgaggtc
atgaaggagatcccgaaggtgcgcgccgaggtgggctacccgccgctcgtcacgccgatg
tcgcagatcgtgggcacgcaggccgtgttcaacgtgctcaccggcaagcgttggagcgtc
gtgtccaaggagatgaaggattacatctgcgggtactacggcaaggcgccgggccgcatg
gacaaggacatcgtggcgaaggtcgtgggcaactccgagatgctgccgcccgacgtggcg
cccggctcgctcgtcaccaccacctacgcgcaggtcgaagaagagatcggcgaccttgcg
aagagcgaggaagacgtgctcatgtacgccctgttcccgaacgaggcgcgcacgttcctc
agcaagcaccggacatcggagaaggtcgacttcctcatggagcaggagtcgagccacacc
aaggaggacgattacgtggacatcaatcagattcgcgagctggttcgcgtcgccgaggaa
agcggcgtcggcgagatcgtagttgaggaagagggcacccgcatcgccgtgcgcatgccg
ggcaccctgtcctccgaagccgccgccgctgccgccgccgctccggttgccgctgtggcc
ccggctccggcagccgccgctcctgccgccgcagcggacgacgtcgagcgcccctccgac
tggtacgccgtcacggctcccatggtgggcacgttctacgcgtcccccgcgccgggcgag
cctccgttcgtgcaggtgggcgacgaggttgccgccaaccagacgctgtgcatcgtcgag
gccatgaagctcatgaacgagatcgcagccgaggagatgggcaccgtccgcgaggtgtgc
ctcgaggacgcgtcccccgtcgagttcggcacggtgctgttctacgtcgagccgcacggc
gccccggccccggccccggagacggcgtaa

DBGET integrated database retrieval system