KEGG   Eggerthella lenta: Elen_2578Help
Entry
Elen_2578         CDS       T00984                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ele  Eggerthella lenta
Pathway
ele00040  Pentose and glucuronate interconversions
ele00052  Galactose metabolism
ele00500  Starch and sucrose metabolism
ele00520  Amino sugar and nucleotide sugar metabolism
ele01100  Metabolic pathways
ele01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Elen_2578
   00052 Galactose metabolism
    Elen_2578
   00500 Starch and sucrose metabolism
    Elen_2578
   00520 Amino sugar and nucleotide sugar metabolism
    Elen_2578
Enzymes [BR:ele01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Elen_2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ACV56531
UniProt: C8WLR8
Position
complement(3017333..3018151)
Genome map
AA seq 272 aa AA seqDB search
MPMKALIPAAGLGTRFLPATKAQPKEMLLVVDRPAIQYVVEEGLASDADEVVIINSREKK
AIEEHFSPNPELVELLRARGKDAYADAVERVGNYNVSYVYQDEALGLGHAVRCAHEKTGD
EPFYVLLGDVLVPDNKMLPRMQEVSDAHGGASVIAVMPVPDDQVSRFGVIAGAAVADDVW
KIDALVEKPALEDAPSNLAVFGRYLLSARVMELLADVEPGVGGEIQLTDALDAVLREEEM
YALIIDPADGFDTGTVESWLETNNVLFGRAAE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgaaggctctcattcccgctgccggcctcggcacgcgcttcctgcccgccacg
aaggcgcagccgaaggaaatgctgctggtagtcgaccgaccggccatccagtacgtggtg
gaggagggcctcgcgtcggacgccgacgaggtggtcatcatcaacagccgcgagaagaag
gccatcgaggagcacttctcgccgaacccggagcttgtggagctgttgcgcgcccgcggg
aaggatgcgtatgccgacgcagtggagcgcgtgggcaactacaacgtgagctacgtgtac
caggacgaggcgctgggcttggggcatgcggtgcggtgcgcgcacgagaagacgggcgac
gagccgttctacgtgctgttgggcgacgtgctggtgcccgacaacaagatgctgccgcgc
atgcaggaggtgtccgacgcacacggcggcgccagcgtcatcgcggtcatgccggttccg
gacgaccaggtcagccgcttcggcgtcatcgcgggcgcggccgtggccgacgacgtgtgg
aagatcgacgcgctggtggagaagccggcgttggaggacgcgccgtcgaacctggccgtg
ttcggccgctacctcctcagcgctcgcgtgatggagcttctggccgacgtcgagcccggc
gtgggcggcgagatccagctgaccgacgcgctggacgccgtgctgcgcgaggaggagatg
tatgcgctgattatcgaccccgccgacggcttcgacaccggcacggtggaaagctggctg
gaaaccaacaacgtgctgttcgggcgcgcagccgaatag

DBGET integrated database retrieval system