KEGG   Escherichia coli LF82: LF82_013Help
Entry
LF82_013          CDS       T00854                                 

Definition
(GenBank) hypothetical protein
  KO
K06887  uncharacterized protein
Organism
elf  Escherichia coli LF82
Brite
KEGG Orthology (KO) [BR:elf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    LF82_013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP PilN_bio_d Sperm_Ag_HE2
Motif
Other DBs
NCBI-ProteinID: CAP74781
Position
complement(242397..242876)
Genome map
AA seq 159 aa AA seqDB search
MANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVTSLSHGLSRAQNVNHQELT
ITKPVDKSSPLLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLANARLSNIGLTVPHT
INDSPGQAEESVSFTYESINWEHSVAGTSAYSLWSERIF
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcccgtctatctgacactgaacggagaacttcaggggctgatttcatccgga
tgctcgtcaatgccgtccatcggtaacaaagcccagattgcacatcaggatcagatcatg
gtgacgtcactgtcccatggtctgagccgtgcgcagaatgtcaaccatcaggagttgacc
atcacgaaaccggtggacaaatcctcccctctgctgggcaaggccatttcagagaatgaa
tgtctgacctgtgattttgtattctaccgcaccaaccgctttggaattaatgaaccgtac
tacaagctgaaactggctaacgcccggctctcaaacatcggccttaccgttccccatacc
attaacgacagtcctgggcaggcggaagagtctgtgtcatttacctatgagagcatcaat
tgggagcacagcgtcgccggaaccagtgcatacagcctttggagtgaacggattttctaa

DBGET integrated database retrieval system