KEGG   Escherichia coli LF82: LF82_014Help
Entry
LF82_014          CDS       T00854                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
elf  Escherichia coli LF82
Brite
KEGG Orthology (KO) [BR:elf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elf02044]
    LF82_014
Secretion system [BR:elf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LF82_014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VasL ImpA_N
Motif
Other DBs
NCBI-ProteinID: CAP74782
Position
complement(242894..244252)
Genome map
AA seq 452 aa AA seqDB search
MSNNALTQTIVTGSDPRALPEFSAIREEINKANHPSQPELNWKLVESLALSIFKANGVDL
HTATYYTLARTRNQGLAGFCEGAELLAAMIIHEWDKFWPQSGPARTEMLDWFNTRTGNIL
RQQVSFSENDLSLLYRTERALQLICDKLQQVELKRQPRVENLLYFVQNTRKRFEPQPRNR
TDTAAQTMVRTLVYAPEGTASATAETMPPLPDLPEMRVGVRGVADNADKAKQGDTVKGFV
AGAACTAVIASALWWWQAYPMQQQLTQVRDTTQGAATVWLASPVLKEYEQYLQQLLNAPP
LQPLETGMQMMRTADTLWPESLQQQEASRMWSNTLRNRAQASPQMKGWQQARQNLRDFAD
LMMKKETEKQGFTLSYIKTVTWQAERLLNQETPLEYLLTQYQETRTQKQDTQALEKEINE
RLDGLLSRWLLLKNTGQDMATDNRTEPVHPTH
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataacgcactgacacaaactatcgttaccggaagcgatccgcgcgccctgccg
gagttcagcgccatccgcgaagaaattaacaaagctaaccacccgtcacagccggagctg
aactggaaactggtggaatcgctggcgctgtcgatttttaaggccaacggggtggatttg
cataccgccacctactatacgctggcacgtacacgtaatcagggactggcagggttctgt
gaaggcgcggaactgctggctgcgatgatcatccacgaatgggataaattctggccgcag
agtggcccggcgcggactgagatgctggactggttcaacacccgcaccgggaatatcctg
cgccagcaggtttccttttccgaaaatgatctttcgttgctctaccgcacggaacgggct
ttgcagcttatctgcgacaaactccagcaagtggaactgaagcgccagccgcgcgtggaa
aatctgctttattttgtgcagaacacacgcaagcggtttgagccgcagcccagaaaccgt
actgatacggcggcacagaccatggtcagaacgctggtctatgcgcctgaaggcacggct
tccgccacagcggaaaccatgccccccctacccgacctgccggaaatgcgggtgggggtg
cgcggtgtggcagataacgccgacaaagcaaaacagggcgacacggtaaaaggttttgtt
gccggtgccgcctgtactgccgttatcgcatctgcactctggtggtggcaggcgtatccg
atgcagcagcagcttacacaggtcagggataccacacagggagccgccaccgtctggttg
gcctccccggtactgaaagaatatgaacagtacctgcaacagcttctgaatgccccgcca
ctacagccgctggaaaccggaatgcagatgatgcgcaccgcagacaccctctggccggaa
agcctgcaacagcaggaagccagcaggatgtggagcaacacgctgagaaaccgggcgcaa
gccagtccgcagatgaagggctggcaacaagcgcggcagaatttgcgggattttgcagat
ttgatgatgaagaaggagacggagaaacagggtttcaccctatcgtatatcaaaacggtg
acctggcaggccgaacggttactgaatcaagaaacaccactggagtacctgctgacgcag
taccaggagacccgtacacagaagcaggacacacaggcgttggaaaaagagatcaacgaa
cggctggacgggctgttaagccgctggctgctgctgaaaaataccggacaggatatggca
acggataacagaaccgaacctgtccatccaactcattga

DBGET integrated database retrieval system