KEGG   Escherichia coli LF82: LF82_021Help
Entry
LF82_021          CDS       T00854                                 

Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
elf  Escherichia coli LF82
Pathway
elf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    LF82_021
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elf02044]
    LF82_021
Secretion system [BR:elf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LF82_021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: CAP74789
Position
complement(254884..255408)
Genome map
AA seq 174 aa AA seqDB search
MNGKAFLACVLMSVVLTGCETAKKISQVIRNPDIQVGKLMDQSTELTVTLLTEPDSNLTA
DGEAAPVDVQLVYLSDDSKFHAADYDQVATTALPDVLGKNYIDHQDFNLLPDTVKTLPPI
KLDEKTGYIGVIAYFSDDQATEWKQIESVESIGHHYRLLVHIRASAIEMKKEEN
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaaagcgtttctggcctgcgttctgatgagcgttgtgttaactggctgtgaa
acagcgaaaaaaatcagccaggtgatccgcaatccggatattcaggtcggaaagctgatg
gatcagtcaaccgagctgaccgtcacgctgctgaccgagccggacagcaacctgacggcg
gatggcgaagccgctccggtggatgtccagttggtttatctgagcgacgactcaaaattc
catgccgccgactacgaccaggttgcaaccaccgcgctgcccgacgtgctggggaaaaac
tatatcgatcaccaggacttcaacctgttgccggataccgtaaaaacactgccgccgatc
aagttggatgagaaaaccggttatatcggtgtcattgcctatttttcagacgaccaggcc
acagaatggaaacaaattgagtcggtagaaagtatcggccaccactatcgcctgctggtg
catatccgcgccagtgcgattgagatgaaaaaagaggaaaactga

DBGET integrated database retrieval system