KEGG   Escherichia coli LF82: LF82_022
Entry
LF82_022          CDS       T00854                                 

Definition
(GenBank) hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
elf  Escherichia coli LF82
Brite
KEGG Orthology (KO) [BR:elf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elf02044]
    LF82_022
Secretion system [BR:elf02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   LF82_022
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-ProteinID: CAP74790
Position
complement(255405..256697)
AA seq 430 aa
MEPLMAEEKQQSRQASLTLQVMNGNELESGRAAKCLFSENGGDIGHTPECHWQVQDRAGS
IAARACTVIRHDGAYCLRCLTPGLMINLAPASSDALIRLRQGDEIQLGALALKVFLHDGA
AVTYDERMATPETIVMNRDSLADTLLTTEGQPAYPGMPFQHQLAPTVAHGFSSDPLQALQ
TESLMVADDPIAPRVSRPVAPASDLTGANGINTPFMDLPPGNARHEDGDEFSAMAQYHLA
VTPLLRGMECPLTLHNSQDADEFLEEAGRALQAAIKGLLSLQQQQNSLSDKHLRPLEDNP
LRLDMDYATALNVMFAEGKSPVHLAAPAAIAESLRNIRHHEEANRAAIVEALRVMLDAFS
PGNLMRRFAQYRRSHELRQKMDNAWAWQMYSNYYDELASSRQQGFEMLFNEVYAQVYDRV
LREKQREPEA
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggaaccacttatggctgaggaaaaacagcaatcccgccaggcctcactgactttacag
gtgatgaatggcaacgaactggaaagcggacgcgccgcaaaatgcctgttcagcgaaaac
ggcggtgatattggccatacgccggaatgtcactggcaggtacaggaccgggcgggaagc
attgctgcgcgtgcctgtaccgttatccggcacgacggagcctattgcctgcggtgcctg
acgccgggactgatgattaatctggccccggcctcttccgatgcgctcatccgcctgcgc
cagggggatgagatccagctcggcgcactggcgctgaaagtgtttctgcatgacggtgca
gctgttacctatgacgagcggatggcgaccccggaaacgattgtaatgaaccgcgacagt
ctggcggacaccctgctgaccaccgagggacaaccggcgtatccgggaatgccgttccag
catcagcttgcccccacggtggcgcacggtttttccagcgatccgctccaggcactccag
acggaaagcctgatggtggcagatgatccgatcgccccacgcgtttcccggcccgttgcc
cccgcctccgatctgacaggtgcaaacgggatcaacacgccgtttatggatctgccaccc
ggcaatgcccgtcatgaggacggcgatgaattttctgccatggcgcagtaccacctggcc
gtaaccccgctgctgcgcggtatggagtgtccgctgacgctgcacaattctcaggatgcg
gatgagtttctcgaagaggccggacgggcgttgcaggccgccattaagggattgctgagt
ctgcaacaacaacagaatagcctgtcggataaacacctgcgtccactggaagacaacccg
ttgcgccttgatatggactatgccaccgcgctgaacgtcatgttcgccgagggtaaaagc
ccggtacatctcgcagcacctgcggccatcgccgaaagcctgcgcaacatccggcatcat
gaagaggccaaccgggcggcgattgtggaagcgttgcgtgtcatgctggacgccttctcg
ccgggcaacctgatgcgccgctttgcgcaataccgccgcagccatgagctgcgccagaaa
atggacaacgcctgggcatggcagatgtacagcaactattacgatgaactggcctccagc
cgacagcagggatttgaaatgctgttcaatgaagtttatgcccaggtctatgaccgggtg
ctgcgcgaaaaacagcgggagccggaagcatga

DBGET integrated database retrieval system