KEGG   Escherichia coli LF82: LF82_024
Entry
LF82_024          CDS       T00854                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
elf  Escherichia coli LF82
Brite
KEGG Orthology (KO) [BR:elf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elf02044]
    LF82_024
Secretion system [BR:elf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LF82_024
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: CAP74792
Position
complement(257715..259556)
AA seq 613 aa
MAFEERYYREELDYLRQLGKLLAQEKPHLAHFLAEKEGDPDVERLMEAFAFMSGSLRQKL
EDEFPEFTHGLIRMLWANYLRPVPAMTVIAYEPKTDQLKVPVQVCRNELIRSRSEKSSLT
AQKVLPDNHDKIVSSVACHFTLARDIWLQPLRILDTRNASSLKEGIIDISFTADNNVSPA
MLDLNKITFWLGNEDDYTRHQLYLWFCECLMDAELIAGEHSLPLPDLWLDAAGFDNQDAL
LPWPKNVHSGYRVLQEYFCYPEAFFFFHLRDVAPLPDDFPVSAFTLRLHFNRPLPADIKL
RQDSLRLHCTPAINLFTHYAEPVRPDGRMAEYPLRASHKHPDAYDIFQVSTVTSKIKVSG
TDSSPGSQVRVWPEFESFQHQMEYSRQREVVYWHHRTKTSLFHYGLEHSIAFVHADGSIP
GSSRFNDDVITTSLICTNRMIPARLHTGDICVAVNKNPAVASFRNVTRPTQPLWPVTDGD
MHWSLISAMNLNYLSLLDRETLIQILRTFDLPGAHHPQRARLSRQKLDAIEKLETKPVDR
LFKGVPVRGLATTLWIRPDPFICEGEIYLLGTVLSHFFALYASINSYHCLKIINTESQEA
WEWQEKMGQHALI
NT seq 1842 nt   +upstreamnt  +downstreamnt
gtggcttttgaagaacgttactaccgcgaagaactggattatctgcgccagcttggcaaa
ctgttggcgcaggaaaaaccgcatctggcccattttctggccgagaaagagggtgatccg
gacgtggagcgtctgatggaagcctttgcctttatgtccggtagcctgcgccagaaactt
gaggacgaattccccgaattcacccatgggctaatccgtatgctgtgggcaaactattta
cgcccggttccggccatgacggttattgcctatgaacccaaaaccgatcagttaaaagtc
cctgttcaggtctgtcgtaatgaactgatcagaagccgctcagaaaagtcctccctgact
gctcagaaggtgctgcctgacaatcatgataaaatcgtttcttccgtagcctgccatttc
acgctggcgcgcgatatctggctgcaaccactgcgcattctcgatacccgcaacgccagc
agtctgaaagaaggcatcatagatatcagttttaccgcagataacaatgtctcccccgcc
atgcttgacctgaacaaaatcacgttctggctgggtaatgaagacgattatacccgacac
cagctttatctgtggttttgcgaatgcctgatggatgcggaactgattgccggagagcac
agcctgccgctgccggatctgtggctggatgctgcgggttttgacaaccaggatgccctg
ctgccgtggccgaaaaatgtccacagcggctaccgcgtgcttcaggagtatttctgctat
cccgaagccttcttctttttccatctgcgcgatgttgcgccgctaccagacgatttcccg
gtgagtgcgtttacgctgcgcctgcactttaaccgcccgttacctgccgacatcaagctg
cgccaggattcgctgcgtctgcactgtacgccagccattaacctgtttacgcattatgcg
gaacccgtcaggccggatgggcggatggcggaatacccgctgcgcgccagccataagcat
ccggacgcctatgacatttttcaggtcagtacagtcaccagtaaaatcaaagtgtcaggg
actgattccagccccggcagccaggtgcgtgtctggcccgaatttgaaagtttccagcac
cagatggagtacagccgccagcgggaagtcgtctactggcatcaccggactaaaacgtcc
ctgtttcactacgggcttgaacatagtatcgcctttgtccatgcagacggtagcattccg
ggcagctcacggtttaacgatgacgtgatcaccacgtcattaatctgtaccaaccgtatg
atccctgcccggctgcataccggtgatatctgcgtggccgtcaacaaaaatccggcagtg
gcctcatttcgtaatgtcacgcgcccgacacagccgctctggccagtcacggacggcgac
atgcactggtcgctgatttccgcgatgaacctgaactacctctccctgctggacagggag
acactgatccagatcctgcggaccttcgacctgccaggcgctcaccatccgcagcgggcc
agactgtcacgccagaaactggatgccatagaaaaactcgaaaccaaacctgttgacagg
ttgtttaaaggcgtaccggttcgcgggctggcgaccacgctgtggatacgtcccgatccg
tttatctgcgaaggtgaaatttatcttctgggtaccgtgctctcgcacttctttgccctc
tacgccagcatcaattcgtaccactgtctgaaaatcattaacacggaaagtcaggaggct
tgggaatggcaggagaaaatgggccagcacgccctgatatag

DBGET integrated database retrieval system