KEGG   Escherichia coli LF82: LF82_027
Entry
LF82_027          CDS       T00854                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
elf  Escherichia coli LF82
Brite
KEGG Orthology (KO) [BR:elf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elf02044]
    LF82_027
Secretion system [BR:elf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LF82_027
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAP74795
Position
complement(261499..262002)
AA seq 167 aa
MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPLDERTAIA
INRYNLNAVISEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRL
LELREALVALKSPLGNIPAFRAQLQALLENEDTREQLIQELGIAVQK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgagcaaaatgaacaacaatggcggcagtgtcgcgccgaaagaaagaatcagcgttcgg
tatacaccaaaagttgatggggtggctgctgatatcgaattgccgctgaatttattgatc
accggcaatctgaaagggaaaccagataacacgccgttggatgagcgaactgccattgct
atcaaccgctataacctcaacgcagtcatttcagaagctgacattgaacgggagtttgtt
gttccggctgaactcagtgacgctcccaatgagcaaatgtacgtcaacctgaaagtcaaa
tctatggatgacctttctcctgaccatattgccagccaggtaccagaaataaaacgtctg
ctcgaattgcgtgaagccctggtcgcacttaagtctccactaggcaatattccggccttc
cgcgcacaacttcaggcgctactggaaaacgaagacacccgcgagcagctgatccaggaa
ctgggtatcgccgttcagaaataa

DBGET integrated database retrieval system