KEGG   Escherichia coli LF82: LF82_032
Entry
LF82_032          CDS       T00854                                 

Definition
(GenBank) receptor protein
Organism
elf  Escherichia coli LF82
SSDB
Motif
Pfam: PAAR_motif DDE_Tnp_1 DUF4150 WbqC
Other DBs
NCBI-ProteinID: CAP74800
Position
268098..268748
AA seq 216 aa
MRDCHSSDDKDVIAIDGKTLRHSYDKSRHIISAFSTMHSLVLGKIRTDEKSNEITAIPEL
LNILDIKGKIITTDAMGGQKDIADKIQKQGGDYLFAVKGNQERLNKAFEEKFPLKELNNP
EHDSYAMSEKSHGTRHDGYYETAITAGSSTVFIDGLPAARQGDPLTPHDKPKHPPHPRKI
ARGSSTVFIDGLPAARTGDAIDCGGVVIGGGTVNIG
NT seq 651 nt   +upstreamnt  +downstreamnt
atgcgtgactgccattcttcagatgataaagacgtcatcgcaattgatggaaaaacgctc
cggcattcttatgacaagagtcgtcatatcattagtgcgttctcaactatgcacagtctg
gtccttggcaaaatcaggacggatgagaaatccaatgagatcacagctatccctgaactt
cttaacatcttggatattaaaggaaaaattatcacaactgatgcgatgggtggccagaaa
gatattgcagataagatacaaaaacagggcggtgattatttattcgctgtaaaaggaaac
caggagcggctaaataaagcctttgaggaaaaatttccgctgaaagaattaaataaccca
gagcatgacagttacgcaatgagtgaaaagagtcacggtacccggcatgacggttattat
gagaccgccatcaccgccgggtcatccaccgtttttatcgatggtctccccgcagcccgt
cagggagatccgctgacgccgcatgataaaccgaagcatccacctcatccccgaaaaatc
gccagaggctcttcaaccgtctttattgacggcctgcccgccgccagaaccggtgatgct
attgactgcggcggcgtggttattggtggcggtacggtaaatataggctga

DBGET integrated database retrieval system