KEGG   Escherichia coli LF82: LF82_1236Help
Entry
LF82_1236         CDS       T00854                                 

Gene name
ltae
Definition
(GenBank) Low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
elf  Escherichia coli LF82
Pathway
elf00260  Glycine, serine and threonine metabolism
elf01100  Metabolic pathways
elf01110  Biosynthesis of secondary metabolites
elf01120  Microbial metabolism in diverse environments
elf01130  Biosynthesis of antibiotics
elf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:elf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LF82_1236 (ltae)
Enzymes [BR:elf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     LF82_1236 (ltae)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 CheD
Motif
Other DBs
NCBI-ProteinID: CAP75338
Structure
PDB: 

Position
complement(859863..860864)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKI
KPDDIHFARTKLLSLENTHNGKVLPREYLKEVWEFTRKRNLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMY
ALKNNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVL
INASPIVRLVTHLDVSREQLAEVAAHWHAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgagccgcgccatgctcgaagcgatg
atggccgccccggttggggacgacgtttacggagacgaccctaccgttaatgctctgcag
gactatgcggcagagctttctggtaaagaagccgccatttttctgcctaccggcactcag
gccaacctggtcgctctgctcagtcactgcgaacgcggcgaagagtatatcgtcggtcag
gccgcgcataactatctgtttgaagccggtggcgcagcagtgctgggcagtattcagccg
caacccatcgacgcagctgccgacggtacgctaccgctggataaagtggcgatgaaaatc
aaacccgacgatatccatttcgcccgcaccaaattactcagtctggaaaacacccacaac
ggcaaagtgctgccgcgtgaatacttaaaagaggtatgggaatttacccgcaagcgcaat
ctggcgctgcatgttgacggtgcgcgcatctttaatgccgtggtggcttacggctgcgaa
ctgaaagagatcacgcaatattgtgactcgttcaccatttgcctgtcgaaaggtcttggg
acgccagtcggttcattactcgtcggtaatcgtgattacattaaacgtgccattcgctgg
cggaaaatgacaggtggcgggatgcgtcagtccggcattctggctgccgccgggatgtat
gccctgaaaaataacgtcgcacgtttgcaggaagaccacgataacgccgcctggatggcg
gagcagttgcgtgaagcaggcgcggatgtgatgcgtcaggacaccaatatgctgtttgtt
cgcgtcggggaagaaaatgctgccgcgttaggcgaatacatgaaagcgagaaacgtgctg
attaacgcctcgccgattgtccgcctggtgacccatcttgacgtctcgcgtgaacaactg
gcggaagttgccgcccactggcatgcgttcctggcgcgttaa

DBGET integrated database retrieval system