KEGG   Escherichia coli LF82: LF82_2443
Entry
LF82_2443         CDS       T00854                                 

Gene name
xdhA
Definition
(GenBank) Xanthine dehydrogenase molybdenum-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
elf  Escherichia coli LF82
Pathway
elf00230  Purine metabolism
elf01100  Metabolic pathways
elf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LF82_2443 (xdhA)
Enzymes [BR:elf01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     LF82_2443 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C DUF4694
Other DBs
NCBI-ProteinID: CAP77304
Position
3001530..3003788
AA seq 752 aa
MRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQARSLPGVLAIFTWE
DVPEIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARDELTAEKAAQLVSI
EWQELPVITSPEAALAEDAAPIHNGGNLLKQSTMSTGNVQQTIDAADYQVQGHYQTPVIQ
HCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVRVIKPFIGGGFGNK
QDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMGVNRDGTLKGYSLD
VLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAGAMRGYGAPQVVFA
VESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECLEKGRKIFEWEKRR
AECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINVQSGATEIGQGADT
VFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPALRSAALLLKEKIIA
HAAVMLHQSAMNLTLIKGHIVLIERPEEPLMSLKDLAMDAFYHPERGGQLSAESSIKTTT
NPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHGGMGMGIGWALFEE
MIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKSLGEPPIIPVAAAI
RNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgcgcgtcgatgccattgctaaggtcaccgggcgggcacgatatactgacgattatgtt
atggcgggcatgtgttacgcgaaatatgtacgtagccctatcgcacatggttatgctgta
agtattaatgatgaacaagccaggagtttgccgggcgtcctggcgatttttacctgggaa
gatgtgccagaaatcccattcgccacggcagggcatgcctggacacttgacgaaaacaag
cgcgataccgccgatcgcgcactgctaactcgccatgttcgtcatcatggcgacgccgtt
gccatcgtcgtggcccgcgatgaactcacggcagaaaaagcggcgcaattggtcagcatt
gagtggcaagaattacccgttatcacctcgccagaagcggcgctggcagaagacgctgca
ccaatccataacggtggcaatttactgaaacaaagcacgatgtcgacgggtaatgtccaa
caaacaatcgatgccgccgactaccaggtacaggggcactatcagactcccgttattcaa
cattgtcatatggaaagcgtgacatcgctggcatggatggaggatgactcgcgaattacc
atcgtttccagcacccagatcccgcacattgttcgccgcgtggttggtcaggcgctggat
attccctggtcatgcgtacgagtcatcaaaccgtttatcggtggcggttttggtaataaa
caggatgtactggaagagccaatggcggcattcctgaccagcaaacttggcggcattccg
gtgaaagtttcccttagccgtgaagagtgtttcctcgcaacccgtacccgccacgctttt
actattgacgggcaaatgggcgtgaaccgcgacggaacattgaaaggttatagtctggat
gttctgtctaacaccggcgcttatgcatctcacgggcactccattgcttctgctgggggg
aataaagtcgcttacctttatcctcgttgtgcctacgcttacagttcaaagacctgctat
accaacctcccctcggctggtgcgatgcgtggttatggcgcgccacaagtcgtatttgcc
gttgagtctatgcttgatgatgccgcgacagcgttaggtattgatcctgttgaaattcgt
ttacgcaacgccgcccgcgaaggagatgctaatccgctcacgggaaaacgtatttacagc
gcagggttgccggagtgtcttgaaaaaggccggaaaatctttgaatgggaaaaacgccgt
gcagagtgccagaaccagcaaggcaatttacgtcgtggcgttggcgtcgcctgttttagc
tacacctctaacacctggcctgtcggcgtagaaatagcaggcgcgcgcctgttgatgaat
caggatggaaccatcaacgtgcaaagcggcgcgacggaaatcggtcagggtgccgacacc
gtcttctcgcaaatggtggcagaaaccgtgggggttccggtcagcgacgttcgcgttatt
tcaacacaagataccgatgttacgccgttcgatcccggcgcatttgcctcacgccagagc
tatgttgccgcgcctgcgctgcgcagtgcggcactgttattaaaagagaaaatcatcgct
cacgccgcagtcatgctacatcagtcagcgatgaatctgaccctgataaaaggccatatc
gtgctgattgaacgaccggaagaaccgttaatgtcgttaaaagatttggcgatggacgct
ttctaccaccctgaacgcggcgggcagctctctgctgaaagctccatcaaaaccaccact
aacccaccggcgttcggctgtacatttgttgatctgacggtcgatattgcactgtgcaaa
gtcaccatcaaccgcatcctcaacgttcatgattcggggcatattctaaatccgctgctg
gcagaaggtcaggtacacggcggaatgggaatgggcattggctgggcgctatttgaagag
atgatcatcgatgcgaaaagcggcgtggtccgtaaccccaatctgctggattacaaaatg
ccgaccatgccggatctgccacaactggaaagcgcgttcgtcgaaatcaatgagccgcaa
tccgcatacggacataagtcactgggtgagccaccaataattcctgttgccgctgctatt
cgtaacgcggtgaagatggctaccggtgttgcaatcaatacactgccgctgacgccaaaa
cggttatatgaagagttccatctggcaggattgatttga

DBGET integrated database retrieval system