KEGG   Escherichia coli LF82: LF82_2445
Entry
LF82_2445         CDS       T00854                                 

Gene name
xdhC
Definition
(GenBank) Xanthine dehydrogenase iron-sulfur-binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
elf  Escherichia coli LF82
Pathway
elf00230  Purine metabolism
elf01100  Metabolic pathways
elf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LF82_2445 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: CAP77306
Position
3004674..3005153
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLFLAAWAEGKEIRTLEGEAKGGKLSHVQLAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcgccaggaatgccgctttcggaactactccgagaacaagggcttcttagtgtc
aaacaaggttgctgcgtaggcgaatgcggtgcctgtacggtgctggtcgacggcactgcg
atagacagttgcttattccttgcggcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggtaaactttctcatgtccaactggcttatgcgaaatctggtgca
gtgcaatgcgggttttgtacgccgggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgtggactggcgggaaatctttgt
cgctgcacagggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system