KEGG   Escherichia coli LF82: LF82_431Help
Entry
LF82_431          CDS       T00854                                 

Definition
(GenBank) Secreted protein Hcp
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
elf  Escherichia coli LF82
Pathway
elf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    LF82_431
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elf02044]
    LF82_431
Secretion system [BR:elf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LF82_431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: CAP77252
Position
2932245..2932736
Genome map
AA seq 163 aa AA seqDB search
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFT
FTKEIDASSPYLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHD
IKDPSREKHNHLERIEFRYEKITWTYKDGNIIHSDSWNERPSA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggctattcctgcttatctctggctgaaagatgacggcggcgcggatatcaaaggttcc
gtggacgttcaggggcgcgaaggtagcatcgaagtggtggcgctggatcacgatgtgtac
atcccgaccgacaataacaccggcaaactgaccggtacccgtactcacaagccttttacg
tttaccaaagaaatcgatgcgtccagcccgtatctctacaaagctgtgaccaccggacag
accctgaaaacggcagaatttaagttttaccgcatcaacgatgccggtcaggaagtggag
tacttcaacatcacgcttgataacgtcaagctggtcagagtcgctccgcttatgcacgac
atcaaggatccttccagagagaagcataaccacctggaacgtattgagttccgctacgag
aaaatcacctggacttacaaagacggcaacatcattcattccgactcgtggaatgagcgt
ccttccgcctga

DBGET integrated database retrieval system