KEGG   Escherichia coli LF82: LF82_635Help
Entry
LF82_635          CDS       T00854                                 

Definition
(GenBank) sorbose PTS component (EC 27169)
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
elf  Escherichia coli LF82
Pathway
elf00051  Fructose and mannose metabolism
elf01100  Metabolic pathways
elf02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:elf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LF82_635
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    LF82_635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elf02000]
    LF82_635
Enzymes [BR:elf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     LF82_635
Transporters [BR:elf02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    LF82_635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: CAP78478
Position
complement(4307885..4308379)
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDEVYNDEVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQDETVFYLFTRPQDALAMVRQGVKIGTLNIGGMAWRPDKKQLTKAV
SLDDDDINAFHELNNLGIILDLRVVASDPSINIIDKINEQLIAN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacgctcgcccgcattgatgaccgcctgatccacggccaggtcactaccgtc
tggtctaaagtggctaacgcccagcgcattattatctgcaatgacgaagtttataacgat
gaagttcgccggacattattgcgtcaggctgcgccaccgggaatgaaggttaacgtggtc
aatattgaaaaagccgtcgcggtttatcacaacccgcaatatcaggacgaaaccgttttt
tatcttttcactcgcccacaggatgccttagcgatggttcgccagggggtaaaaataggc
accctgaatattggcggcatggcctggcggcccgataaaaaacagttaaccaaagcggtt
tcattagatgatgatgatattaacgcatttcatgagttaaataatcttggcatcatactg
gatttacgcgtcgtagcgtcagatccctcaatcaatattatcgacaaaataaacgaacag
ttaatcgcaaattaa

DBGET integrated database retrieval system