KEGG   Enterobacter ludwigii EN-119: BH714_01370Help
Entry
BH714_01370       CDS       T04719                                 

Definition
(GenBank) NAD(P)H nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
elg  Enterobacter ludwigii EN-119
Pathway
elg00633  Nitrotoluene degradation
elg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BH714_01370
Enzymes [BR:elg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     BH714_01370
  1.-  
   1.-.-  
    1.-.-.-  
     BH714_01370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AOT42038
Position
complement(291047..291700)
Genome map
AA seq 217 aa AA seqDB search
MDIISVALKRHSTKAFDPSKKLTAEEAEKIKTLLQYSPSSTNSQPWHFIIASTEEGKARV
AKSAAGTYVFNERKMMDASHVVVFCAKTAMDDAWLERVVDQEEADGRFNTPEAKAANHKG
RCYFADMHRVDLKDDDQWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKE
KGFTSLVVVPVGHHSVEDFNAALPKSRLPLSTIVTEC
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcatttccgttgccctgaaacgccactccaccaaggcgtttgacccaagcaag
aaactgaccgctgaagaagcggagaagatcaaaaccctgctgcagtacagcccgtccagc
acgaactcccagccatggcattttattattgccagcactgaggaaggtaaagcgcgcgtg
gccaaatctgcggcaggcacttacgtgttcaacgaacgcaaaatgatggacgcctctcat
gtggtagtgttctgcgcgaaaaccgccatggacgatgcgtggcttgagcgcgtcgtggat
caggaagaggccgacggtcgcttcaacaccccagaagcaaaagcggcgaatcacaaaggt
cgctgctatttcgccgacatgcaccgcgtggatctgaaagatgacgaccagtggatggcg
aaacaggtttacctcaacgtcggtaacttcctgttaggcgtggccgcgctgggcctggat
gccgtacccattgaaggttttgacgccgccattctcgacgcagagtttggcctgaaagag
aaaggcttcaccagcctggtggtggtcccggttggacaccacagcgtggaagatttcaac
gccgcgctgccaaaatctcgcctgccgctgagcacgattgtgaccgagtgctaa

DBGET integrated database retrieval system