KEGG   Enterobacter ludwigii EN-119: BH714_04085Help
Entry
BH714_04085       CDS       T04719                                 

Definition
(GenBank) bifunctional glucose-1-phosphatase/inositol phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
elg  Enterobacter ludwigii EN-119
Pathway
elg00010  Glycolysis / Gluconeogenesis
elg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH714_04085
Enzymes [BR:elg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     BH714_04085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AOT42513
Position
882270..883511
Genome map
AA seq 413 aa AA seqDB search
MRKALLALAIAGSITVTSGVQAQETPEGYQLEQVLIMSRHNLRAPLANNGSVLEQSTPKQ
WPEWEVPGGQLTTKGGVLEVYMGHYMREWLAQQGMVKTGECPAADSVYAYANSLQRTVAT
AQFFITGAFPGCDVPVHHQEKIGTMDPTFNPVITDNSPEFREKALKAMETERQKMQLGES
YKLLEQMTNYADSPSCKEKNVCSLAEAKDTFSADYEKEPGVSGPLKVGNSLVDAFTLQYY
EGFPADQVAWGEIKTDQQWRVLSQLKNGYQDSLFTSTEVAQNVAKPLVKYIDQALVTGQA
KAPKITLLVGHDSNIASLLTALDFKPYQLHDQHERTPIGGKIVFQRWHDKNANQELMKIE
YVYQSADQLRNASVLSLDAPAQRVTLELKGCPVDANGFCPIDKFNAVMNNAAK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcactactcgcgctggcaatcgccggttccataacagtgacatctggcgtg
caggcgcaagagacgccggaagggtatcagctggaacaagttttaatcatgagtcgccat
aatttgcgcgcgccgctcgccaacaatggcagcgtgctcgagcaatccacaccgaagcag
tggccagaatgggaggtgccaggcggccagctcaccaccaaaggtggcgtgcttgaagtc
tatatgggccactatatgcgcgagtggctggcacagcagggaatggtgaaaaccggcgag
tgcccggccgcggatagcgtatatgcctatgccaacagcctgcagcgcactgtcgccacc
gcgcagttctttatcaccggcgccttcccggggtgcgatgtgcctgtgcatcatcaggaa
aaaataggcaccatggatccgacctttaacccagtgattacggataactcacctgaattc
cgtgaaaaagcgctgaaggcgatggaaactgagcggcagaaaatgcagcttggcgagagc
tacaagctgctggagcagatgacgaattacgccgattcaccgtcctgtaaagagaagaac
gtgtgctcgctggcggaggcgaaagataccttcagcgctgactatgaaaaagaacctggc
gtatcgggtccgttaaaagtcggtaactcgctggtggatgccttcacgctgcagtattac
gaaggcttcccggcagaccaggttgcctggggtgaaattaaaaccgatcaacagtggcgc
gtgttgtcgcagctgaaaaatggctatcaggactcgctgtttacctccaccgaggtggcg
caaaacgtggccaaaccgctggtgaagtatatcgaccaggccctcgtcaccgggcaggcg
aaagcgccgaaaatcaccctgctggtggggcatgattccaatatcgcgtcgctgcttacg
gcgctggatttcaaaccgtaccagctgcatgaccagcacgagcggacgccaattggcggg
aaaattgttttccagcgctggcatgataaaaacgccaaccaggagctcatgaagattgag
tatgtctatcagagcgccgaccagttgcgtaacgccagcgtattatcactggatgcgccg
gcacagcgtgtgacgctggagctgaaggggtgtccggttgatgcgaacggtttttgccca
atcgataaattcaatgcggtgatgaataacgcggcgaaatag

DBGET integrated database retrieval system