KEGG   Enterobacter ludwigii: BH714_05455Help
Entry
BH714_05455       CDS       T04719                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
elg  Enterobacter ludwigii
Pathway
elg00071  Fatty acid degradation
elg00072  Synthesis and degradation of ketone bodies
elg00280  Valine, leucine and isoleucine degradation
elg00310  Lysine degradation
elg00362  Benzoate degradation
elg00380  Tryptophan metabolism
elg00620  Pyruvate metabolism
elg00630  Glyoxylate and dicarboxylate metabolism
elg00640  Propanoate metabolism
elg00650  Butanoate metabolism
elg00900  Terpenoid backbone biosynthesis
elg01100  Metabolic pathways
elg01110  Biosynthesis of secondary metabolites
elg01120  Microbial metabolism in diverse environments
elg01130  Biosynthesis of antibiotics
elg01200  Carbon metabolism
elg01212  Fatty acid metabolism
elg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:elg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BH714_05455
   00630 Glyoxylate and dicarboxylate metabolism
    BH714_05455
   00640 Propanoate metabolism
    BH714_05455
   00650 Butanoate metabolism
    BH714_05455
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BH714_05455
   00072 Synthesis and degradation of ketone bodies
    BH714_05455
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BH714_05455
   00310 Lysine degradation
    BH714_05455
   00380 Tryptophan metabolism
    BH714_05455
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BH714_05455
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BH714_05455
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BH714_05455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elg04147]
    BH714_05455
Enzymes [BR:elg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BH714_05455
Exosome [BR:elg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BH714_05455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOT42763
Position
complement(1142618..1143799)
Genome map
AA seq 393 aa AA seqDB search
MNEVMIVGATRTPVGSFRGSLSSLSAVELGAVAVRRLLENSQLCADQVDELIFGQVLTAG
CGQNPARQTALTAGLPVSTPATTANLVCGAGLKAVQLAAQAIRCGDADVVIAGGQESMSN
APYLLDGARSGLRFGHTGLQDSMITDGLWDAFNDYHMGITAENVARQYGISREQQDAFAA
RSQQKAASAIARGLFDAEMAPVTVSEGKKPPRLVSSDEQPRPGTTAEQLAQLRPAFRRED
GTVTAGNASTLNDGAAAVLLMSGEKARESGLPILGRVVSYAVTGVDPSVMGIGPVSACQT
ALARAGWALDEVDVIEANEAFAAQALAVGKLLGWDERKVNVNGGAIALGHPIGASGCRIL
VTLLHEMQRRDAKKGLVTLCVGGGQGIALTLAR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggtcatgattgtcggggccacgcgaacccctgtaggcagttttcgcggatcg
ctctcctccctttccgcggttgaactgggtgccgtagcggttcgtcgcctgcttgagaac
agccagctgtgcgcagatcaggtagacgaactgattttcggtcaggtgctgacggcaggg
tgcggacaaaaccccgcccgtcagaccgctctcacggccggattgcccgtcagtaccccc
gcgacaaccgccaatctggtgtgcggtgctggtttaaaagcggtgcagctcgccgcgcag
gctatccgctgcggcgatgccgacgtggttatcgctggcggccaggagagcatgagcaat
gccccttacctgctggacggtgcgcggtcagggttgcgttttggtcatacagggttgcag
gacagcatgataacggacggcctgtgggacgcatttaacgattatcacatgggcatcacc
gcggaaaacgttgcccgccagtatggtatctcccgcgagcagcaggacgcttttgccgcc
cggtcgcagcaaaaagcggcgtcggccattgcgcgcggtctgtttgacgcggagatggct
ccggtcacggtgagcgagggtaaaaagccgccgcgcctggtcagcagtgatgaacaaccc
cggccgggaaccaccgctgagcaactcgctcagttgcgccctgcctttcgtcgtgaagat
ggaacggtcactgcgggtaatgcctcaaccctgaacgatggtgccgctgcggtgctgttg
atgagcggtgaaaaagcgcgggaaagcggattaccgatcctgggacgggtcgtgagttat
gccgtgaccggcgttgatccatcggtgatgggcatcgggccggtcagcgcctgccagacg
gctctggcccgggcaggctgggcgctggatgaggtggacgtcattgaagcgaatgaagcc
tttgccgcacaggcgctggccgttggcaaactgctcggctgggatgaacgtaaggtgaac
gtaaacggtggtgcgattgcgcttggccaccctatcggcgcttctggctgtcggatcctc
gtcacgctgctgcatgagatgcaacgccgcgacgcgaaaaaagggctcgtcaccctgtgt
gtgggaggtgggcaaggcattgcattaacccttgcgcgctaa

DBGET integrated database retrieval system