KEGG   Enterobacter ludwigii EN-119: BH714_07150Help
Entry
BH714_07150       CDS       T04719                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
elg  Enterobacter ludwigii EN-119
Pathway
elg00250  Alanine, aspartate and glutamate metabolism
elg00650  Butanoate metabolism
elg00760  Nicotinate and nicotinamide metabolism
elg01100  Metabolic pathways
elg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BH714_07150
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BH714_07150
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BH714_07150
Enzymes [BR:elg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     BH714_07150
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     BH714_07150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOT43081
Position
1507090..1508478
Genome map
AA seq 462 aa AA seqDB search
MTYSSATHALSVNPATGETLAAYPWASTDDVERAIAQADAGFRQWRRVSVSDRAQKLRDL
ASALRDRADEMARMISREMGKPILQARAEVAKSASLCDWYAEHGPAMLQPEPTLVENQNA
VIEYRPLGPVLAVMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVLGSADLIAQVFADAG
FPQGVFGWVNATNEGVSQAINDRRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLNDADLDLAVKAAVAGRYQNTGQVCAAAKRFIVEEGIADAFTQRFVEATAALKMGTP
DREENFIGPMARFDLRDELHQQVQATLAEGAMLLLGGEKVAGEGNYYAPTVLGNVTASMT
AFRQELFGPVAAVSVAKDAEHALQLANDSDFGLSATVFTANDTLAEKFSRELECGGVFIN
GFSASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKNRV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacttattcctctgctacacatgccctctctgttaacccagccaccggcgagacgctc
gcggcgtatccgtgggcgagcaccgacgacgttgaacgcgcaattgcgcaggctgatgcc
ggttttcgtcagtggagacgcgtaagcgtttcagaccgggcgcagaagctgcgcgatctc
gccagcgcgctgcgcgatcgtgcagacgagatggcccgaatgatctcccgtgagatgggc
aaacccattttgcaggcgcgtgctgaagtggcaaaatccgccagcctctgcgactggtat
gcggaacacggcccggcaatgctgcagcctgaaccgaccctggtagaaaaccagaacgcg
gtgattgaataccggccgctgggacctgttcttgccgtcatgccgtggaacttcccgctc
tggcaggtactgcgtggcgcggtacccattctgctggccgggaacagctatctgctcaag
catgcgccaaacgtactcggctcggctgaccttattgcgcaggtatttgctgacgccggt
tttccgcagggtgtctttggctgggtgaatgccacgaatgagggcgtgagccaggcgatc
aacgaccgtcgtattgccgctgtaaccgtaaccggcagcgtgcgcgcgggtgcggcgatt
ggtgcgcaggcgggggcagcactcaagaaatgcgttctggagctgggcggttcagatccg
tttattgtgctcaatgatgctgatttggatctggcggtgaaagcagccgtggccggacgt
tatcagaataccggacaggtttgcgccgccgctaagcgctttattgtggaagagggcatc
gctgatgctttcacccagcgttttgtcgaggcgacggcagccctgaagatggggacgccg
gatcgcgaagaaaactttattggcccgatggcgcgatttgacctgcgcgatgaactgcat
cagcaggtgcaggccacgctggccgaaggcgccatgctgctgcttggcggggagaaagtc
gccggtgaagggaactactatgcaccgaccgtgctggggaatgtcactgccagcatgacg
gcatttcgtcaggagctgtttggtccggttgcggcggttagcgttgcgaaagacgcggag
cacgcgctgcagctggctaacgacagcgactttggtctgtccgcaaccgtctttaccgcg
aacgatacgctggcggagaaattctcccgtgagctggagtgcggtggggtgttcatcaat
ggtttcagcgccagcgatgcgcgcgtggcctttggcggcgtgaagaagagcggttttggt
cgtgagctttcccacttcggtctgcacgagttctgtaacgtgcagacggtatggaagaac
agagtctag

DBGET integrated database retrieval system