KEGG   Enterobacter ludwigii EN-119: BH714_11650Help
Entry
BH714_11650       CDS       T04719                                 

Definition
(GenBank) two-component system sensor histidine kinase/response regulator
  KO
K07677  two-component system, NarL family, capsular synthesis sensor histidine kinase RcsC [EC:2.7.13.3]
Organism
elg  Enterobacter ludwigii EN-119
Pathway
elg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:elg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BH714_11650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elg01001]
    BH714_11650
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:elg02022]
    BH714_11650
Enzymes [BR:elg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BH714_11650
Protein kinases [BR:elg01001]
 Histidine kinases
  NarL family
   BH714_11650
Two-component system [BR:elg02022]
 NarL family
  RcsC-RcsD-RcsB (capsule synthesis)
   BH714_11650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RcsC Response_reg HATPase_c HisKA
Motif
Other DBs
NCBI-ProteinID: AOT43874
UniProt: G8LKN7
Position
complement(2479893..2482739)
Genome map
AA seq 948 aa AA seqDB search
MKYLVSFRTTLKVSRYLFRALALLLWLLVALLSVFYIVNALHQKEAEIRQEFNLSSDQAQ
RYIQRTSDVMKELKYIAENRLTAENGILAIRGRNDKTEVPNFEPLFPDSDCSAMGSTWRG
SLESLSWFMRYWRDNFSAAYDLNRVFLIGSENLCMADFGLRDVPVERDDALKSLHERIVK
YRNAPQDERGNNIFWISQGPRMGVGYFYALTPVYLGNRLQALLGIEQTIRMENFFTPGSL
PMGVTILDENGHTLISLAGPDNRLNVDPHWMQERSWFGYTSGFRELVLKKSLPPSSLSIV
YSLPVDMVLERIRILIMNAILLNLLAGGALFTLARMYERKIFIPAESDAQRLEEHEQFNR
KIVASAPVGICILRTQDGTNILSNELAHNYLNMLTHEDRQRLTQIICGQQVNFVDVLTST
HTNLQISFVHSRYRNENVAICVLVDVSARVKMEESLQEMAQAAEQASQSKSMFLATVSHE
LRTPLYGIIGNLDLLQTKELPKGVDRLVTAMNNSSSLLLKIISDILDFSKIESEQLKIEP
REFSPREVMNHISANYLPLVVRKQLGLYCFIEPDVPLTLHGDPMRLQQVISNLLSNAIKF
TDIGCIVLHVCRAGDYLSIRVRDTGVGIPAKEVVRLFDPFFQVGTGVQRNFQGTGLGLAI
CEKLVSMMDGDISVDTEPGMGSQFTIRIPLYSAQYPAKAVVDGLSDKRCWLAVHNASLND
YLTALLTHSGVRVSRYEGQTPDVDDVLITDEVLEQPWQGRGVVHFCRRHIGIPVERAPGE
WVHSVATPHELMSLLARIYSVQLEDSDGATELPSPDALASLNDDMMILVVDDHPINRRLL
ADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLTQRIRQLGLTLPVV
GVTANALAEEKQRCLESGMDSCLSKPVTLDVLKQTISVYAERVRKARV
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatacctcgtctcctttcgtaccacgctgaaagtctctcgctatctgtttcgggcg
ctggcgctcttgctttggttgctggtggcattattgtcggtgttttacatcgttaacgcc
cttcatcagaaagaagcggagatccgccaggagtttaacttaagctccgatcaggcccag
cgctatattcagcgaacgtccgacgtgatgaaggagctgaagtacattgccgagaatcgc
ctgaccgcggaaaacggcattcttgccatccgtgggcgtaatgacaaaaccgaagtaccg
aatttcgagccgctgtttccggattccgattgctctgcgatgggcagcacctggcgcggt
tcactggagtcgctctcctggtttatgcgctactggcgtgacaacttttccgccgcctat
gatctgaaccgcgtcttcctgattggcagtgaaaatctctgtatggccgactttggcctg
cgcgatgtgcccgttgagcgcgatgatgcgctgaaaagcctgcacgaacggattgtgaaa
tatcgcaatgcgccgcaggacgagcgcgggaataacatcttctggataagccaggggcca
cgcatgggcgtgggctatttctacgccctcacgccggtctatctgggtaatcgtctgcag
gcgctgctggggattgaacagaccattcgcatggaaaacttcttcacgccgggcagtctg
ccgatgggcgtgaccattctggatgaaaacggacataccctgatctcactcgccggtccg
gataatcgactgaacgtcgatccgcactggatgcaggagcggtcgtggtttggctatacc
tcaggcttccgtgagctggtgcttaaaaagagcttgccgccttcgtcgctgagtattgtc
tattcgctgcccgtggatatggtgcttgagcggatccgcattcttatcatgaacgcgatt
ttgctgaacctgctggccgggggggcgctgtttaccctggcgcgaatgtatgagcgcaaa
atctttatacccgccgaaagcgacgcccagcggctggaagagcacgagcagtttaaccgc
aagattgtcgcctcggcgccggtggggatctgcatcctgcgcacgcaggacgggaccaat
atcctcagtaacgagctggcgcataactacctgaacatgctgacgcatgaggaccgacag
aggctgacgcagattatctgtggccagcaggtgaacttcgttgacgtgctgaccagcacg
cacacgaacctgcaaatcagctttgtgcactcccgctatcgtaatgagaacgtggcaatt
tgcgtcctggtagacgtctcggcgcgtgtgaagatggaagagtccctgcaggagatggcg
caggccgctgagcaggccagccagtcgaaatccatgttccttgccaccgtcagccacgag
ttgcgtaccccgctgtacgggattatcggtaaccttgatcttctgcagaccaaagagctg
ccgaaaggggtcgatcgcctggtgacggcgatgaataactcctccagcctgctgctgaaa
atcatcagcgatattctcgatttctccaaaattgagtcggagcagctgaaaattgagccg
cgggagttctctccgcgcgaggtgatgaaccacatcagcgccaactatctgccgctggtg
gtgcgtaaacagctgggcctctactgctttattgagccggacgtgccgctgacgctgcat
ggcgatccgatgcgtctgcagcaggtcatttctaacctgctcagtaacgccattaaattt
accgatatcggctgcattgtgttgcacgtgtgtcgggcaggggactacctgagtattcgt
gtgcgtgataccggcgtgggtatcccggcgaaggaagtggtgcgtctgtttgacccgttc
ttccaggtcggtaccggcgtacagcgtaacttccaggggaccgggctgggtctggcgatc
tgtgagaagctcgtgagcatgatggacggcgatatctccgttgataccgagccaggcatg
ggcagccagtttactatccgcattccgctctattctgcccagtatccggcaaaagcggtg
gtggacggcctgagcgataagcgctgctggctggcagtacacaatgcctcactgaatgat
tacctgacggcgcttcttacccacagcggcgtgcgcgtgtcccgctatgaagggcaaacg
ccggatgtcgacgatgtgctgatcaccgacgaggtgctggagcaaccctggcagggcaga
ggggtggttcatttctgccgtcgccatatcggtattccggtcgaacgagctccgggtgaa
tgggtgcacagcgtggcgacgccgcatgagctcatgagcctgctggcacgtatctacagc
gtgcagctggaagatagcgatggggcgacggagttgccgtcaccggatgcgctggcatcg
ctgaatgacgatatgatgattctggtggtggatgaccatccgattaaccgtcgcctgctg
gcagaccagttgggttcgcttggctatcagtgcaaaaccgccaatgacggcgtggatgcg
ctgaacgtgctgagtaaaaaccacattgatatcgttcttagcgacgtcaacatgccgaat
atggatggctaccgtctgacgcagcgtatacgccagcttggcctgacgttgccggtcgtg
ggcgtgacggcgaatgcgctggcggaagagaaacagcgctgtctggagtcagggatggac
agttgtctgtcgaaaccggtgacgctggacgtcctgaaacagacgatttccgtgtatgcg
gaacgggtcagaaaagcgagagtataa

DBGET integrated database retrieval system