KEGG   Enterobacter ludwigii EN-119: BH714_13750Help
Entry
BH714_13750       CDS       T04719                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
elg  Enterobacter ludwigii EN-119
Pathway
elg00010  Glycolysis / Gluconeogenesis
elg00020  Citrate cycle (TCA cycle)
elg00620  Pyruvate metabolism
elg01100  Metabolic pathways
elg01110  Biosynthesis of secondary metabolites
elg01120  Microbial metabolism in diverse environments
elg01130  Biosynthesis of antibiotics
elg01200  Carbon metabolism
Module
elg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:elg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH714_13750
   00020 Citrate cycle (TCA cycle)
    BH714_13750
   00620 Pyruvate metabolism
    BH714_13750
Enzymes [BR:elg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     BH714_13750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AOT44243
UniProt: G8LIA9
Position
2917568..2919187
Genome map
AA seq 539 aa AA seqDB search
MRVTGLTPQDLKAYGIHDVQEIVYNPDYDTLYQEELNPALEGYERGVLTNLGAIAVDTGI
FTGRSPKDKYIVRDETTRDTLWWADKGKGKNDNKPLSPETWQHLKGLVTHQLSGKRLFIV
DAFCGANADTRLSVRFITEVAWQAHFVKNMFIRPDDKELQDFTPDFIVMNGAKCTNPQWK
EQGLNSENFIAFNLTERIQLIGGTWYGGEMKKGMFSVMNYLLPLRGIASMHCSANVGEKG
DVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIRLSEEAEPDIF
HAIRRDALLENVTVRADGTIDFDDASKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFLT
ADAFGVLPPVSRLTASQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLSLHPTQY
AEVLVKRMQASGAQAYLVNTGWNGTGKRISIKDTRAIIDAILDGSLDNAETFTLPMFDLA
IPTALPGVETRILDPRNTYGSPEQWREKAESLAKLFIENFEKYTDTPAGEALVSAGPKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgttactggtttaaccccgcaagatctcaaggcttatggtattcacgacgtccag
gaaatcgtctacaaccccgattacgatacgctgtatcaggaagagctcaatccagcactg
gaaggatacgagcgaggtgtgttgactaaccttggtgctatcgccgtcgataccggtatc
tttaccggtcgttcgccgaaagataaatacatcgtccgagacgagaccacccgcgacacg
ctgtggtgggctgataaaggcaaagggaagaacgataacaaaccgctctctccggaaacc
tggcagcatctgaaagggctcgttacccatcaactttccggcaagcgtctgtttatcgtt
gatgctttctgcggcgctaacgccgatacccgcctttccgtgcggtttatcactgaagtg
gcctggcaggcgcatttcgtgaaaaacatgtttattcgtcctgacgacaaagagctgcag
gatttcacccctgacttcatcgtgatgaacggggcgaaatgcacgaacccacagtggaaa
gagcagggtcttaactccgagaacttcatcgccttcaacctgaccgagcgtattcagctg
atcggcggtacctggtacggcggcgaaatgaagaaagggatgttctcggtgatgaactac
ctgctgccgctgcgcggtatcgcctccatgcactgttcggcaaacgtcggtgaaaaaggg
gatgtggcggtgttcttcggcctgtccggcaccggtaaaaccaccctttctaccgatccg
aaacgtcgtctgattggcgatgacgagcacggctgggatgatgacggcgtgtttaacttc
gaagggggctgctacgcgaagaccattcgcctgtctgaagaagcggagccagatatcttc
catgccatccgccgcgatgcgctgctggaaaacgtcaccgtacgtgccgatggaacgatc
gacttcgacgatgcttcgaaaaccgaaaacacccgcgtgtcttaccctatctaccacatc
gacaacatcgtgaagccggtgtcaaaagcgggccacgcgacgaaggtgattttcctgacg
gcagatgcgttcggcgtgttgcctccggtgtcccgcctgaccgccagccagacgcagtac
cacttcctgtctggttttaccgccaaactggccggtaccgagcgcggcgtgacggagcca
acgccaaccttctccgcctgcttcggcgcagcgttcctgtcgctgcacccgacgcagtac
gcggaagtgctggtcaaacgcatgcaggcgtccggtgcacaggcgtacctggtgaatacc
ggctggaacggcaccggcaaacgtatctccatcaaagatacccgcgccattatcgacgcc
attctggatggttcactcgataacgccgaaaccttcacgctgccgatgtttgatctggca
atcccgacggcgctgccgggcgtagagacccgtattctcgacccacgcaatacctacggt
tcaccggagcagtggcgtgagaaagcagaatcgctggcgaaactgtttattgagaacttc
gagaagtataccgataccccggcaggtgaagcgctggtgagtgcgggaccgaagctgtaa

DBGET integrated database retrieval system