KEGG   Enterobacter ludwigii: BH714_17225Help
Entry
BH714_17225       CDS       T04719                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
elg  Enterobacter ludwigii
Pathway
elg00052  Galactose metabolism
elg00500  Starch and sucrose metabolism
elg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BH714_17225
   00500 Starch and sucrose metabolism
    BH714_17225
Enzymes [BR:elg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     BH714_17225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 DUF4975
Motif
Other DBs
NCBI-ProteinID: AOT44864
Position
3663371..3664807
Genome map
AA seq 478 aa AA seqDB search
MTSLLELAERTLEKAQSAINSRWYPRYHLAARAGWMNDPNGLVWFDGWYHAFYQHHPYSP
EWGPMHWGHARSKDLVHWEHLSVALAPEGPADKDGCFSGSAVVDGDTLALIYTGHKFHGS
PDTDDNLYQVQCLATSRDGIHFERHGLVIDTPPGLHHFRDPKVWREGEFWYMVVGSRVEN
TGQVRLYRSTDLREWHDEGVFAEAEDGKGFMWECPDFFTLGGKRVLMFSPQGMAAEGYHH
RNLFQSGYLLGEWQPGQPFSHNGQFIELDHGHDFYAPQSFLTPDGRRIVIGWLDMWESPM
PERQDGWAGMLSLPRELSLTDDRRLRMKPAEEVTALRGSYYPMPVRCLNNQQVPVAADAE
AVEVQLVWDLSASTAERFGMALGDGLRIYVDDQARRLVLERRYPEYSLEGTRSIPLPADN
LLSLRIFIDRSSVEVFVNDGEACLSSRIYPQPGQRDISLFASHGAASLHDAGYWSLER
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacatccttattagaactggctgaacggacgcttgaaaaagcacaatccgctattaat
tcgcgctggtatccgcgctatcaccttgccgctcgcgcaggctggatgaacgatcctaac
ggcctggtatggtttgacggttggtatcacgcgttttatcaacatcacccttattcccct
gaatgggggccgatgcactgggggcatgcccgcagcaaggatctggtgcactgggaacat
ctgtcggtcgcgctggctcccgaaggcccggcggataaagacggctgcttctccggctcc
gccgtggtggacggcgataccctggcgctgatttataccggacataagtttcacggttcg
ccagacaccgacgacaatctctaccaggtgcagtgtctggcaaccagccgtgacggcatc
cattttgaacggcatggcctggtgattgataccccgccagggctgcaccattttcgcgat
ccgaaggtgtggcgcgaaggtgagttctggtacatggttgtcggttcccgcgtggagaat
accggccaggtgcgcctgtaccgctccaccgatctccgcgaatggcacgacgaaggcgtg
tttgccgaggccgaagacggcaagggttttatgtgggaatgcccggatttctttaccctg
ggagggaagcgcgtcctgatgttctccccacagggcatggcggcggaagggtatcaccat
cgcaacctcttccagagtggctacctgctcggggagtggcagccaggccaaccgtttagc
cataacggacagtttattgagctggaccacggccacgacttttatgctccgcaaagtttc
ctgaccccggatggtcgccgcatcgtcatcggctggctggatatgtgggaatcgccgatg
ccagaacggcaggatggctgggccggtatgctctctctgccgcgcgaattaagccttacc
gacgatcgtcgtctgaggatgaagcccgccgaggaggtcaccgccctgcgcggcagctat
tatccgatgccggttcgctgcctgaataatcagcaagtccccgtcgcggcagatgccgaa
gcggtcgaagtgcagctggtatgggatctgagcgcctctacggccgaacggtttggcatg
gcattgggcgacgggctgagaatatatgtcgacgatcaggcgaggcgtctggtgctggag
cgtcgctatccggagtattcgcttgaaggcacgcgcagcattccgctgccagcggataac
ctactgtcactgcgcatctttattgaccgctcatcagtggaggtttttgttaacgatggc
gaagcttgcttaagcagccgaatttatccgcagccgggccagcgcgatatttcactgttt
gccagtcatggcgccgcctcattacatgacgccggatactggtctctggagagataa

DBGET integrated database retrieval system