KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_0111Help
Entry
ETEC_0111         CDS       T02069                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
elh00010  Glycolysis / Gluconeogenesis
elh00020  Citrate cycle (TCA cycle)
elh00620  Pyruvate metabolism
elh01100  Metabolic pathways
elh01110  Biosynthesis of secondary metabolites
elh01120  Microbial metabolism in diverse environments
elh01130  Biosynthesis of antibiotics
elh01200  Carbon metabolism
Module
elh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:elh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETEC_0111
   00020 Citrate cycle (TCA cycle)
    ETEC_0111
   00620 Pyruvate metabolism
    ETEC_0111
Enzymes [BR:elh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ETEC_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: CBI99612
UniProt: E3PCG5
Structure
PDB: 

Position
129122..131002
Genome map
AA seq 626 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTQTGALIMIFDSADGAADAAPAQAEEKKETAPAAAPAAAAAKDVNVPDIGSDEVEV
TEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNVGDKVSTGSLIMVFEVA
GEAGAAAPAAKQEAAPAAAPAPAAGVKEVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLIT
VEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAKQEAAAPAPAAKAE
APAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQAY
VKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIP
HVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVVFIMKAVAAALEQMPRFNSSLSED
GQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTAGEMQ
GGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLSFDHR
VIDGADGARFITIINNTLSDIRRLVM
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtgggcgacaaagttgaagccgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagttccgtctccgcaggcgggtatcgttaaagagatcaaagtctct
gttggcgataaaacccagaccggcgcactgattatgattttcgattccgccgacggtgca
gcagacgctgcacctgctcaggcagaagagaagaaagaaacagctccggcagcagcacca
gcggctgcagcggcaaaagacgttaacgttccggatatcggcagcgacgaagttgaagtg
accgaaatcctggtgaaagttggcgataaagttgaagctgaacagtcgctgatcaccgta
gaaggcgataaagcttctatggaagttccggctccgtttgctggcaccgtgaaagagatc
aaagtgaacgtgggtgacaaagtgtctaccggctcgctgattatggtcttcgaagtcgcg
ggtgaagcaggcgcggcagctccggcggctaaacaggaagcggctccggcagcggcccct
gcaccagcggctggcgtgaaagaagttaacgttccggatatcggcggtgacgaagttgaa
gtgaccgaagtgatggtgaaagtgggcgacaaagttgccgctgaacagtcactgatcacc
gtagaaggcgataaagcttctatggaagtcccggctccgtttgcaggcgtcgtgaaggaa
ctgaaagtcaacgttggcgataaagtgaaaactggctcgctgattatgatcttcgaagtt
gaaggcgcagcgcctgcgaaacaggaagcggcagcgccggctccggcagcaaaagctgaa
gctccggcagcagcaccggctgcgaaagcggaaggcaaatctgaatttgcagaaaacgac
gcttacgttcacgcgactccgctgatccgccgtctggcacgcgagtttggcgttaacctg
gcgaaagtgaagggcactggccgtaaaggtcgtatcctgcgcgaagacgttcaggcttac
gtgaaagaagctatcaaacgtgcagaagcagctccggcggcgactggcggcggtatccca
ggcatgctgccgtggccgaaggtggacttcagcaagtttggtgaaatcgaagaagtggaa
ctgggccgtatccagaaaatttctggtgcgaacctgagccgtaactgggtgatgatcccg
catgttactcacttcgacaaaaccgatatcaccgagctggaagcgttccgtaaacagcag
aacgaagaagcggcgaaacgtaagctggatgtgaagatcaccccggttgtcttcatcatg
aaagccgttgctgcagctcttgagcagatgcctcgcttcaacagttcgttgtcggaagac
ggtcagcgtctgaccctgaagaaatacatcaacatcggtgtggcggtggataccccgaac
ggtctggttgttccggtattcaaagacgtcaacaagaaaggcatcatcgagctgtctcgc
gagctgatgactatttctaagaaagcgcgtgacggtaagctgactgcgggcgaaatgcag
ggcggttgcttcaccatctccagcatcggcggcctgggtactacccacttcgcgccgatt
gtgaacgcgccggaagtggctatcctcggcgtttccaagtccgcgatggagccggtgtgg
aatggtaaagagttcgtgccgcgtctgatgctgccgatttctctctccttcgaccaccgc
gtgatcgacggtgctgatggtgcccgtttcattaccatcattaacaacacgctgtctgac
attcgccgtctggtgatgtaa

DBGET integrated database retrieval system