KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_0403Help
Entry
ETEC_0403         CDS       T02069                                 

Definition
(GenBank) 3-(3-hydroxy-phenyl)propionate hydroxylase
  KO
K05712  3-(3-hydroxy-phenyl)propionate hydroxylase [EC:1.14.13.127]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
elh00360  Phenylalanine metabolism
elh01100  Metabolic pathways
elh01120  Microbial metabolism in diverse environments
elh01220  Degradation of aromatic compounds
Module
elh_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:elh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    ETEC_0403
Enzymes [BR:elh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.127  3-(3-hydroxyphenyl)propanoate hydroxylase
     ETEC_0403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Pyr_redox_2 Pyr_redox Pyr_redox_3 HI0933_like NAD_binding_8 2-Hacid_dh_C Thi4 TrkA_N UDPG_MGDP_dh_N DAO Lycopene_cycl ThiF
Motif
Other DBs
NCBI-ProteinID: CBI99908
UniProt: E3PES4
Position
431113..432777
Genome map
AA seq 554 aa AA seqDB search
MAIQHPDIQPAVNHSVQVAIAGAGPVGLMMANYLGQMGIDVLVVEKLDKLIDYPRAIGID
DEALRTMQSVGLVDDVLPHTTPWHAMRFLTPKGRCFADIQPMTDEFGWPRRNAFIQPQVD
AVMLEGVSRFPNVRCLFSRELEAFSQQDDEVTLHLKTAEGQREIVKAQWLVACDGGASFV
RRTLNVPFEGKTAPNQWIVVDIANDPLSTPHIYLCCDPVRPYVSAALPHAVRRFEFMVMP
GETEEQLREPQNMRKLLSKVLPNPDNVELIRQRVYTHNARLAQRFRIDRVLLAGDAAHIM
PVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLNTYQQERRDHAKAMIDLSVTAGNVL
APPKRWQGTLRDGVSWLLNYLPPVKRYFLEMRFKPMPQYYGGALVREGEAKHSPVGKMFI
QPKVTLENGDVTLLDNAIGANFAVIGWGCNPLWGMSDEQIQQWRALGTRFIQVVPEVQIH
TAQDNHDGVLRVGDTQGRLRSWFAQHNASLVVMRPDRFVAATAIPQTLGKTLNKLASVMT
LTRPDADVSVEKVA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcaatacaacaccctgacatccagcctgctgttaaccatagcgttcaggtggcgatc
gctggtgccggcccggttgggctgatgatggcgaactatctcggccagatgggcattgac
gtgctggtggtggagaaactcgataagttgatcgactacccgcgtgcgattggtattgat
gacgaggcgctgcgcaccatgcagtcggtcggcctggtcgatgatgttctgccgcacact
acgccgtggcacgcgatgcgttttctcaccccgaaaggccgctgttttgctgatattcag
ccaatgaccgatgaatttggctggccgcgccgtaacgcctttattcagccgcaggtcgat
gcggtgatgctggaaggggtgtcgcgttttccgaatgtgcgctgcttgttttcccgcgag
ctggaggccttcagtcagcaagatgacgaagtgaccttgcacctgaaaacggcagaaggg
cagcgggaaatagtcaaagcccagtggctggtggcctgtgatggtggggcaagttttgtc
cgtcgcaccctgaatgtgccgtttgaaggtaaaactgcgccaaatcagtggattgtggta
gatatcgccaacgatccgttaagtacgccgcatatctatttgtgttgcgatccggtgcgc
ccgtatgtttctgccgcgctacctcatgcggtacgtcgctttgaatttatggtgatgcca
ggagaaaccgaagaacagctgcgtgagccgcaaaatatgcgcaagctgttaagcaaagtg
ctgcctaatccggacaatgttgaattgattcgccagcgtgtctacacccacaacgcgcga
ctggcgcaacgtttccgtattgatcgcgtactgctggcgggcgatgccgcgcacatcatg
ccggtgtggcaggggcagggctataacagtggtatgcgcgacgcctttaacctcgcatgg
aaactggcgttggttatccaggggaaagcccgcgatgcgctgctcaatacctatcaacaa
gaacgtcgcgatcacgccaaagcgatgattgacctgtccgtgacggcgggcaacgtgctg
gctccaccgaaacgctggcagggtacgttacgtgacggcgtttcctggctgctgaattat
ctgccgccagtaaaacgctacttcctcgaaatgcgcttcaagccgatgccgcaatattac
ggcggtgcgctggtacgtgagggcgaagcgaagcactctccggtcggcaagatgtttatt
cagccgaaagtcacgctggaaaacggcgacgtgacgctgctcgataacgcgatcggcgcg
aacttcgcggtaattggctggggatgcaatccactgtgggggatgagcgacgagcaaatc
cagcagtggcgcgcgttgggcacacgctttattcaggtggtgccggaagtgcaaattcat
acggcacaggataaccacgacggcgtgctacgcgtgggcgatacgcaaggtcgtctgcgt
agctggttcgcacaacacaatgcttcgctggtggtgatgcgcccggatcgctttgttgcc
gccaccgccattccgcaaaccctgggcaagaccctgaataaactggcgtcggtgatgacg
ctgacccgccctgatgccgacgtttctgtcgaaaaggtagcctga

DBGET integrated database retrieval system