KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_0624Help
Entry
ETEC_0624         CDS       T02069                                 

Definition
(GenBank) enterobactin synthetase component E [includes: 2,3-dihydroxybenzoate-AMP ligase; S-dihydroxybenzoyltransferase]
  KO
K02363  2,3-dihydroxybenzoate-AMP ligase [EC:6.3.2.14 2.7.7.58]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
elh01053  Biosynthesis of siderophore group nonribosomal peptides
elh01110  Biosynthesis of secondary metabolites
elh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:elh00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    ETEC_0624
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:elh01008]
    ETEC_0624
Enzymes [BR:elh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.58  (2,3-dihydroxybenzoyl)adenylate synthase
     ETEC_0624
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     ETEC_0624
Polyketide biosynthesis proteins [BR:elh01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    ETEC_0624
   Bacillibactin synthetase
    ETEC_0624
  Nonlinear NRPS
   Vibriobactin synthetase
    ETEC_0624
   Myxochelin synthetase
    ETEC_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C GH3 Autoind_bind
Motif
Other DBs
NCBI-ProteinID: CBJ00130
UniProt: E3PGK3
Structure
PDB: 

Position
679700..681310
Genome map
AA seq 536 aa AA seqDB search
MSIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDGERQLSYRELNQAADN
LACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIE
PALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSP
ADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSS
PGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLA
SLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMC
PDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISID
PEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVV
KEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGKVDKKQLRQWLASRASA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgagcattccattcacccgctggccggaagagtttgcccgtcgctatcgggaaaaaggc
tactggcaggatttgccgctgaccgacattctgacgcgacatgctgcgagtgacagcatc
gcggttatcgacggcgagcgacagttgagttatcgggagctgaatcaggcggcggataac
ctcgcgtgtagtttacgccgtcagggcattaaacctggtgaaaccgcgctggtacaactg
ggtaacgtcgctgaattgtatattacctttttcgcgctgctgaaactgggcgttgcgccg
gtgctggcgttgttcagccatcagcgtagtgaactgaacgcctatgccagccagattgaa
cccgcattgctgattgccgatcgccaacatgcgctgtttagcggggatgatttcctcaat
actttcgtcacagaacattcctccattcgcgtggtgcaactgctcaacgacagcggtgag
cataacttgcaggatgcgattaaccatccggctgaggattttactgccacgccatcacct
gctgatgaagtggcctatttccagctttccggtggcaccaccggcacaccgaaactgatc
ccgcgcactcataacgactactactacagcgtgcgtcgtagcgtcgagatttgtcagttc
acacaacagacacgctacctgtgcgcgatcccggcggctcataactacgccatgagttcg
ccaggatcgctgggcgtctttcttgccggaggaacggttgttctggcggccgatcccagc
gccacgctctgtttcccattgattgaaaaacatcaggttaacgttaccgcgctggtgcca
cccgcagtcagcctgtggttgcaggcgctgatcgaaggcgaaagccgggcgcagcttgcc
tcgctgaaactgttacaggtcggcggcgcacgtctttctgccacccttgcggcgcgtatt
cccgctgagattggctgtcagttgcagcaggtgtttggcatggcggaagggctggtgaac
tacacccgacttgatgatagcgcggagaaaattatccatacccagggttacccaatgtgt
ccggatgacgaagtatgggttgccgatgccgaaggaaatccactgccgcaaggggaagtc
ggacgcctgatgacgcgcgggccgtacaccttccgcggctattacaaaagtccacagcac
aatgccagcgcctttgatgccaacggtttttactgttccggcgatctgatctctattgat
ccagagggttacatcaccgtgcaggggcgcgagaaagatcagattaaccgtggcggcgag
aagatcgctgccgaagagatcgaaaacctgctgctgcgccacccggcggtgatctacgcc
gcactggtgagcatggaagatgagctgatgggcgaaaaaagctgcgcttatctggtggta
aaagagccgctgcgcgcggtgcaggtgcgtcgtttcctgcgtgaacagggtattgccgaa
tttaaattaccggatcgcgtggagtgtgtggattcacttccgctgacggcggtcgggaaa
gtcgataaaaaacaattacgtcagtggctggcgtcacgcgcatcagcctga

DBGET integrated database retrieval system