KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_3060
Entry
ETEC_3060         CDS       T02069                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
elh00230  Purine metabolism
elh01100  Metabolic pathways
elh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETEC_3060
Enzymes [BR:elh01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ETEC_3060
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: CBJ02562
UniProt: E3PIE3
Position
3303143..3305401
AA seq 752 aa
MRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQARSLPGVLAIFTWE
DVPDIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARDELTAEKAAQLVSI
EWQELPVITTPEAALAEDAAPIHNGGNLLKQSTMSTGNVQQTIDAADYQVQGHYQTPVIQ
HCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVRVIKPFVGGGFGNK
QDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMGVNRDGTLKGYSLD
VLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAGAMRGYGAPQVVFA
VESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECLEKGRKIFEWEKRR
AECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINVQSGATEIGQGADT
VFSQMVAEPVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPALRSAALLLKEKIIA
HAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERGGQLSAESSIKTTT
NPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHGGMGMGIGWALFEE
MIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKSLGEPPIIPVAAAI
RNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgcgcgtcgatgccattgctaaggtcaccgggcgggcacgatatactgacgattatgtt
atggcgggcatgtgttatgcgaaatatgtacgtagccctatcgcacatggttatgccgta
agtattaatgatgaacaagccagaagtttgccgggcgtactggcgatttttacctgggaa
gatgtgcctgatattccattcgctacagctgggcatgcctggacacttgacgaaaacaag
cgcgataccgccgatcgcgcactgctaactcgccatgttcgtcatcatggtgacgccgtt
gccatcgtcgtggcccgcgatgaactcacggcagaaaaagcggcgcaattggtcagcatt
gagtggcaagaattacccgttatcaccacgccagaagcggcgctggcagaagacgctgca
ccaatccataacggtggcaatttactgaaacaaagcacgatgtcgacgggtaatgtccaa
caaacaatcgatgccgccgactaccaggtacaggggcattatcagacccccgttattcaa
cattgtcacatggaaagcgtaacatcgctggcgtggatggaggatgactcgcgaattacc
atcgtttccagcacccagatcccgcacattgttcgccgcgtggttggtcaggcgctggat
attccctggtcatgcgtacgagtcatcaaaccatttgtcggtggcggttttggtaataaa
caggatgtactggaagagccaatggcggcattcctgaccagcaagcttggcggcattccg
gtgaaagtttcccttagccgtgaagagtgtttcctcgcaacccgtacccgccacgctttt
accattgacgggcaaatgggcgtgaaccgcgacggaacattgaaaggttatagtctggat
gttctgtctaacaccggcgcttatgcatctcacgggcactccatcgcttctgcggggggg
aataaagtcgcttacctttatcctcgttgtgcctacgcttacagttcaaagacctgctat
accaacctcccctcggctggtgcgatgcgtggttatggcgcgccacaagtcgtatttgcc
gttgagtctatgcttgatgacgccgcgacagcgttaggtattgatcctgttgaaattcgt
ttacgcaacgccgcccgcgaaggagatgctaatccgctcacgggcaaacgtatttacagc
gcagggttgccggagtgtcttgaaaaaggccggaaaatctttgaatgggaaaaacgccgt
gcagaatgccagaaccagcaaggcaatttgcgccgcggcgttggcgtcgcctgttttagc
tacacctctaacacctggcctgtcggcgtagaaatagcaggcgcgcgccttctgatgaat
caggatggaaccatcaacgtgcaaagcggcgcgacggaaatcggtcagggtgccgacacc
gtcttctcgcaaatggtggcagaacccgtgggggttccggtcagcgacgttcgcgttatt
tcaactcaagataccgacgttacgccgttcgatcccggcgcatttgcctcacgccagagc
tatgttgccgcgcctgcgctgcgcagtgcggcactattattaaaagagaaaatcatcgct
cacgccgcagtcatgctacatcagtcagcgatgaatctgaccctgataaaaggccatatc
gtgctggttgaacgaccggaagagccgttaatgtcgttaaaagatttggcgatggacgct
ttctaccaccctgaacgcggcgggcagctctctgctgaaagctccatcaaaaccaccact
aacccaccggcgtttggctgtacctttgttgatctgacggtcgatattgcgctgtgcaaa
gtcaccatcaaccgcatcctcaacgttcatgattcagggcatattcttaatccactgctg
gcagaaggtcaggtacacggcggaatgggaatgggcattggctgggcgctatttgaagag
atgatcatcgatgctaaaagcggcgtggtccgtaaccccaatctgctggattacaaaatg
ccgaccatgccggatctgccacaactggaaagcgcgttcgtcgaaatcaatgagccgcaa
tccgcatacggacataagtcactgggtgagccaccaataattcctgttgccgctgctatt
cgtaacgcggtgaagatggctaccggtgttgcaatcaatacactgccgctgacgccaaaa
cggttatatgaagagttccatctggcaggattgatttga

DBGET integrated database retrieval system