KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_3062
Entry
ETEC_3062         CDS       T02069                                 

Definition
(GenBank) xanthine dehydrogenase iron-sulfur-binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
elh00230  Purine metabolism
elh01100  Metabolic pathways
elh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETEC_3062
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: CBJ02564
UniProt: E3PIE5
Position
3306287..3306766
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEEKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagagaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system