KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_4210Help
Entry
ETEC_4210         CDS       T02069                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Pathway
elh00670  One carbon pool by folate
elh01100  Metabolic pathways
elh01120  Microbial metabolism in diverse environments
elh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:elh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ETEC_4210
Enzymes [BR:elh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ETEC_4210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: CBJ03715
UniProt: E3PB73
Structure
PDB: 

Position
4555123..4556013
Genome map
AA seq 296 aa AA seqDB search
MSFFHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTY
GANSGERDRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGD
LPPGSGKPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRA
ITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFD
GLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPGL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttttcacgccagccagcgggatgccctgaatcagagcctggcagaagtccag
gggcagattaacgtttcgttcgagtttttcccgccgcgtaccagtgaaatggagcagacc
ctgtggaactccatcgatcgccttagcagcctgaaaccgaagtttgtatcggtgacctat
ggcgcgaactccggcgagcgcgaccgtacgcacagcattattaaaggcattaaagatcgc
actggtctggaagcggcaccgcatcttacttgcattgatgcgacgcccgacgagctgcgc
accattgcacgcgactactggaataacggtattcgtcatatcgtggcgctgcgtggcgat
ctgccgccgggaagtggtaagccagaaatgtatgcttctgacctggtgacgctgttaaaa
gaagtggcagatttcgatatctccgtggcggcgtatccggaagttcacccggaagcaaaa
agcgctcaggcggatttgcttaatctgaaacgcaaagtggatgccggagccaaccgcgcg
attactcagttcttcttcgatgtcgaaagctacctgcgttttcgtgaccgctgtgtatcg
gcgggcattgatgtggaaattattccgggaattttgccggtatctaactttaaacaggcg
aagaaatttgccgatatgaccaacgtgcgtattccggcgtggatggcgcaaatgttcgac
ggtctggatgatgatgccgaaacccgcaaactggttggcgcgaatattgccatggatatg
gtgaagattttaagccgtgaaggagtgaaagatttccacttctatacgcttaaccgtgct
gaaatgagttacgcgatttgccatacgctgggggttcgacctggtttataa

DBGET integrated database retrieval system