KEGG   Escherichia coli O78 H11 K80 H10407 (ETEC): ETEC_p666_0300Help
Entry
ETEC_p666_0300    CDS       T02069                                 

Gene name
traB
Definition
(GenBank) pilus assembly protein TraB
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
elh  Escherichia coli O78:H11:K80 H10407 (ETEC)
Brite
KEGG Orthology (KO) [BR:elh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elh02044]
    ETEC_p666_0300 (traB)
Secretion system [BR:elh02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ETEC_p666_0300 (traB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI Lebercilin CALCOCO1 TAP42 ATG16 HAUS6_N DivIC
Motif
Other DBs
NCBI-ProteinID: CBJ04392
UniProt: D0Z6Y6
Position
p666:complement(23361..24812)
Genome map
AA seq 483 aa AA seqDB search
MASINTIVKRKQYLWLGIVVVGTASAIGGALYLSDVDMSGNGETVAEQEPVPDMTGVVDT
TFDDKVRQHATTEMQVTAAQMQKQYEEIRRELDVLNKQRGDDQRRIEKLGQDNAALAEQV
KALGANPVTATGEPVPQMPASPPGPEGEPQPGNTPVSFPPQGSVAVPPPTAFYPGNGVTP
PPQVTYQSVPVPNRIQRKVFTRNEGKQGPSLPYIPSGSFAKAMLIEGADANASVTGNEST
VPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERAIVRTRNISCLKDGKTIDMPIK
GHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLGATAAYGASDV
LKIGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMALEQS
QSTAEEGNPESPVPNLPSAESHLNGFNTDQMLKQLGNLNPQQFMSGDKNPQGGDAGREGG
NGG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggccagtatcaataccattgtgaaacgcaagcagtacctgtggctggggattgtggtt
gtcggtacagcctccgcgattggtggggcactgtatctgtctgatgtggacatgtccggt
aacggtgaaaccgtggctgaacaggagcctgtgccggatatgaccggtgtggtggatacg
acctttgatgacaaggtgcgtcagcatgccaccacagagatgcaggtgacggcagcgcag
atgcagaagcagtatgaggaaatccgtcgtgagctggatgttctgaacaaacagcgcggt
gatgaccagcgtcgtattgaaaagctgggacaggacaatgccgccctggcagagcaggta
aaagccctgggtgctaatcccgtcacggcgaccggtgagcctgtaccgcagatgcctgcc
tcaccgcccggcccggaaggcgaaccacagccaggaaacacccccgtatccttcccgccg
cagggcagcgttgctgttccaccgccgacggcgttttatcccgggaatggtgtcacgcca
ccaccacaggtgacgtaccagtctgtgccggtgcctaaccggatacagcgtaaggtgttt
acccgtaatgagggaaaacagggaccatcactgccgtacattccgtcaggaagttttgcg
aaagccatgctgattgaaggggcggatgccaatgcctctgtcaccggtaatgaatccacg
gtgccgatgcagttgcgtatcaccggcctggtggaaatgccgaacagcaaaacgtatgac
gcaacgggatgttttgtggggctggaagcctggggggatgtctccagtgagcgtgccatc
gtgcgcacccgtaacatcagctgcctgaaggacggcaaaactattgatatgccgattaag
gggcatgtcagcttccggggtaaaaacggtatcaagggcgaagtggtgatgcgtaacggc
aaaatcctcggctgggcatggggcgcgggatttgttgacggtatcggtcagggaatggag
cgcgcctcccagccggctgtcgggctgggggctactgccgcttacggggccagtgatgtc
ctgaaaataggtatcggtggcggtgcatcgaaagccgcacagacgctcagtgactactac
atcaaacgtgctgagcagtatcacccggtgataccgattggtgcgggcaatgaagtgacg
gtggtgttccaggatggcttccagctgaaaaccgtggaggaaatggcgctggagcagtca
cagagtacagcggaagagggtaacccggaaagccctgtgccgaatcttccctcggcagaa
agccacctgaacggttttaacaccgaccagatgctgaaacagctgggcaatctgaatccg
cagcagtttatgtccggagacaagaacccgcagggcggggatgccggcagggagggcgga
aatggcgggtga

DBGET integrated database retrieval system