KEGG   Erythrobacter litoralis HTCC2594: ELI_01860Help
Entry
ELI_01860         CDS       T00315                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00330  Arginine and proline metabolism
eli00332  Carbapenem biosynthesis
eli01100  Metabolic pathways
eli01130  Biosynthesis of antibiotics
eli01230  Biosynthesis of amino acids
Module
eli_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ELI_01860
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ELI_01860
Enzymes [BR:eli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ELI_01860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA IF3_N PA
Motif
Other DBs
NCBI-ProteinID: ABC62464
UniProt: Q2NCX7
Position
418199..419317
Genome map
AA seq 372 aa AA seqDB search
MVADLSDLARSQRLVVKVGSSLLVEHGEARADWLKSLAQDLAQLRAKGTKVIVVSSGAIA
LGAARLGFEKGGRGSLSDAQASASVGQIALAGLWSQALGDVGLTAAQILLSLDDLEDRAR
YLNASATLGRLLDAGAVPVVNENDSVATEEIRFGDNDRLAARVAQAAGADAVLLLSDVDG
LFTADPAAPDSELVGRIEGITPEVLAMASAASSSGLGSGGMVSKLQAAQIAERAGIALAI
INGTHEAPIARALDTGVGTVFVPQRSDGARKAWLGGRLAPQGTLRVDAGCAQALQGGASL
LAAGIVGISGAFRRGDLVSIVTVSGRKIAQGLAEYDSSECQAIIGKREGDQAAILGYAPR
AAVIHRDHMVML
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgccgatctgagcgatcttgcccgatcccagcgtcttgtggtcaaggttggcagc
tcgctgctggtcgagcacggcgaggcgcgcgcggattggctgaaatcgctggcgcaggac
ctcgcccagcttcgtgcgaaaggcacgaaggtcatcgtcgtcagttcgggcgccattgcg
ctcggcgcggcgcggctgggcttcgagaagggcggacgcggcagcctgtcggatgctcag
gcgagcgcatcggtcgggcagattgcgctggccgggctctggtcgcaggcactcggcgat
gtcgggctgaccgcagcgcagatcctcctttcgctcgatgatctcgaagaccgcgcgcgc
tatctcaacgcctcggctaccctggggcgattgctggatgccggtgcagtgccggtggtg
aacgagaacgacagcgtggcaaccgaagagatccgcttcggcgacaacgaccggctggcc
gcgcgcgtggcgcaggccgcgggtgccgacgcggtgctgctgctgagcgatgtcgacggg
ctctttacggccgacccggcggcgccggacagcgaactggttggccggatcgaggggatc
acgcccgaagtgctcgcgatggcgagcgccgcctcctcatccggcttgggctcgggcggg
atggtctcgaagctgcaggccgcgcagatcgccgagcgggccggtattgcgctggcgatc
atcaacggcacccacgaagcgccgattgcgcgggcactggataccggcgtcggcaccgtg
ttcgttccgcagcgcagcgatggcgcgcgcaaggcgtggctcggcgggcgattggctccg
caaggcacgctgcgcgtcgatgcgggatgtgctcaagcgctgcaaggcggtgcgagcctg
ctggcggccgggatcgtcggcatttcgggggcgttccggcgcggcgatctcgtcagcatc
gtgacggtgtcgggccggaagatcgcgcaggggctcgccgaatacgattcctccgaatgc
caggccatcatcggcaagcgcgagggtgatcaggccgccatcctgggctatgccccgcgc
gcagcagtgatccaccgcgatcacatggtcatgctttga

DBGET integrated database retrieval system