KEGG   Erythrobacter litoralis HTCC2594: ELI_01995Help
Entry
ELI_01995         CDS       T00315                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00230  Purine metabolism
eli00250  Alanine, aspartate and glutamate metabolism
eli01100  Metabolic pathways
Module
eli_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:eli00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ELI_01995
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ELI_01995
Enzymes [BR:eli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     ELI_01995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ABC62491
UniProt: Q2NCV0
Position
444868..446157
Genome map
AA seq 429 aa AA seqDB search
MANVTVIGAQWGDEGKGKIVDWLADRADAVVRFQGGHNAGHTLVVDGTTYKLSLLPSGIV
SGTLSIIGNGVVLDPWALKQEVEKLEGQGVTINDDNFAIADNCPLILPIHRDLDGLREAA
AGTGKIGTTGRGIGPAYEDKVGRRAIRVCDLEHLDSLEPQLDRLCAHHDALRAGFEEPPV
DRERLLGDLREIAPFVLRFAQPVWKRLKKVRKAGAKILFEGAQGVLLDVDHGTYPFVTSS
NTVSGTAASGSGLGPGAAGFVLGIVKAYTTRVGSGPFPTELDDEIGQRLGERGHEFGTVT
GRQRRVGWFDAVLVRQTCAISGVTGIALTKIDVLDGLDTVKICTGYRLNNNVYDYLPSHA
ASQAAVEPIYEEMEGWSESTAGARSFADLPANAVKYIQRIQELIECPVALVSTSPERDDT
ILMRDPFMD
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgtaaccgtaatcggcgcccagtggggcgatgagggcaagggcaagatcgtc
gactggctggccgaccgcgccgatgcggtcgtacggtttcagggtgggcacaatgccggc
cacacgctggtggtcgatggcaccacttacaagctgagcctgctgccgagcgggatcgtg
tcgggcacgttgtcgataatcggcaatggtgtcgtgctcgatccgtgggcgctcaagcaa
gaggtcgagaagctcgaggggcagggcgtcacgatcaacgacgacaatttcgccatcgcc
gacaattgcccgctgatcctgccgatccaccgcgatctcgacggcctgcgtgaagctgca
gccggtaccggcaagatcggcaccaccggtcgcggcatcggcccggcttatgaagacaag
gtcggccgccgcgcgatccgcgtgtgcgacctcgaacatctcgacagcctggagccgcag
ctcgaccgcctctgcgcccatcacgatgcgctgcgcgccgggttcgaggagccgcccgtg
gatcgggagcggctattgggcgaccttcgcgaaatcgcgcccttcgtgctccgctttgcg
cagccggtgtggaagcggctgaagaaagtgcgcaaggcgggcgcgaagatcctctttgaa
ggcgcgcagggcgtgctgctcgatgtcgatcacggcacctatcccttcgtcaccagttcc
aacaccgtcagcggcacggcagcgagcggcagcggattagggccaggggcggcgggcttc
gtcctcggcatcgtcaaggcctataccacccgcgtcggcagcggccctttcccgaccgaa
ctcgacgatgaaatcggccagcggctgggtgagcgagggcatgaattcggcaccgtcact
ggtcgccagcgccgggtcggatggttcgatgccgtgctggtgcgccagacctgcgcgatc
agtggcgtaaccggtatcgcgctgaccaagatcgacgtgcttgatgggctggatacggtg
aagatctgcacgggctaccggcttaacaataatgtctacgattacctgccgagccatgcc
gcgagccaggcggcggtggaaccgatctacgaggaaatggaaggctggagcgaaagcact
gccggcgcgcggagctttgccgacctgcccgccaatgcggtgaaatacatccagcgcatc
caggaactgatcgaatgcccagtggcgctggtctcgaccagccccgagcgtgacgacacc
attttgatgcgcgatccgtttatggattga

DBGET integrated database retrieval system