KEGG   Erythrobacter litoralis HTCC2594: ELI_04210
Entry
ELI_04210         CDS       T00315                                 
Name
(GenBank) TraD
Organism
eli  Erythrobacter litoralis HTCC2594
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf AAA_16 DUF87 HerA_C ResIII AAA_7 AAA_22 AAA_30 AAA_25 CbiA SRP54 T2SSE FtsK_SpoIIIE AAA_19
Other DBs
NCBI-ProteinID: ABC62934
UniProt: Q2NBK7
Position
866799..869138
AA seq 779 aa
MKHNLVNFTRGSQLLGHFGFMFAAGLKGPLIVTFLVVLGLVYWDVSGALDDYQVYLLWMH
AYASGYAFMEFDPDKLVNLKLADGSLVAFPISVVTDYPPMREAVALFRSAVISALWLAGF
ILAPLFALFWWVAERFGEKSKQKKHVRGAELATLRELDREIAAHNRNARAREYGDALGWR
WRLAGSASLRDAGFYSPAHLAGVSWPWRLEQSHAMLVGTTGTGKTVVLTELTREIRERGE
RAVIFDLTGAFVETFYDPKRDIILNPLDARCPAWSVFNDCSTRAEFHAAAESLVPHDGGG
AEQFWVLAARTLFVETCLKLAEAGRGTNAALAHELMNADLSDLHRLVEDTMAGPISTPSA
ARMAESVRAVFNVNAKALQMLPEDGTPFSVREWVNGAGEPGSILFLSARYIDMSVLSQLL
TLWLDTAINTLMAGQRSRDIRLWFLIDELGALHRLPSLEKGLQTARNFGGAIVTGIHAFA
KLKDVYGENMAMTLSSLARTKLILGTADRETATWCSDIIGHREVREMEEGYSYGYNNARD
AVSLTPRRQVVPLLLPDELMKLKNLHGFIKFPEGFPAAPVVLEPRNWPRVAEGFIPRDMP
KLPPQTRHADDNEGAGGGAGAASETGDNDGDPRRMRNAHDRTDSAEKKADQEEKKEPRRT
RRSNKVEQARPDQTRKARDPNAPGKRATSDPQRPAQSELPLSSKAEEHRGMEQRAVPSAR
SDIPDPAAHQRAQVARGKADQRLQEEQQKSLLGGAAKQGRDADQGQDHGHDYGDFDPDM
NT seq 2340 nt   +upstreamnt  +downstreamnt
atgaagcataatctcgtcaacttcacccgcggcagccagcttctggggcatttcggcttc
atgtttgctgcgggcctcaaggggcccctgatcgtgaccttcctggtcgttctcggcctg
gtctattgggacgtaagcggggcgctagacgactaccaggtctacctcctgtggatgcat
gcctatgcctctggttatgccttcatggagttcgatccggacaagcttgtgaacctcaag
ctggccgatgggagcctcgtcgcatttcccatttccgtcgtgaccgattacccgccgatg
cgcgaagcggtcgcgctattccggagtgcggtgatcagcgctttgtggcttgccgggttc
attcttgcgccgctcttcgcgcttttctggtgggttgccgaacgcttcggcgagaagtcc
aaacagaagaagcatgtgcgcggggcggagcttgctaccttgcgtgaacttgaccgggag
atcgccgcgcacaaccgcaatgcccgtgcccgcgagtatggcgatgcgttgggctggcgc
tggcgtctggccgggtcggcttcgctgcgggatgcgggcttctattctcccgcgcatctg
gcaggggtcagctggccttggcgcctcgagcagagccacgcgatgcttgttggcacaacc
gggacaggcaagaccgtcgtcctaaccgagcttaccagggagatccgtgaacggggcgaa
cgtgcggtcattttcgatcttaccggggcctttgtcgaaaccttctacgatcccaaacgc
gacatcattctcaacccgctcgacgcgcgctgtcccgcatggagcgtgttcaacgattgc
tcgacacgtgccgaattccatgccgcggcggagtccctcgtcccgcacgatgggggcggt
gccgaacagttctgggtgctcgccgcgcgcacgctgttcgtcgagacctgtctcaagctc
gccgaagctgggaggggcaccaacgccgcgctcgcccacgaactcatgaacgccgatctc
tccgatctgcaccgtctcgtcgaagataccatggccggtcccatcagcacgccgagcgcg
gcgcgcatggcggaatcggtgcgtgcagtgttcaatgtcaacgccaaggcgctccagatg
ctgcccgaagacgggacgcccttttcggtccgcgagtgggtcaacggggcaggtgaaccg
ggctctatcctgtttctgtccgcgcgctacatcgacatgagcgtgctctcgcagctgctc
accctgtggctcgataccgcgatcaatacgctgatggcgggccagcgctcgcgggacatc
aggctctggttcctgatcgacgaactgggcgcgctgcatcgcctgccttcgctcgagaag
ggcctccagaccgcgcgcaatttcgggggcgcgatcgtcaccgggatccatgcctttgcc
aagctcaaggatgtctacggcgagaacatggccatgaccctgtcctcgcttgcccgaacc
aagctgatcctcggcacagcagatcgcgagaccgccacctggtgttccgatatcattggc
caccgcgaggttcgcgagatggaggaaggatacagctacggctataacaatgcgcgcgac
gcggtaagcctgacgccccggcgccaggtcgtcccactgctgcttcccgacgagctgatg
aagctcaagaacctacatggtttcatcaagtttcccgaaggatttccggcggcacccgtg
gtcctcgaaccgcgcaactggcctcgggtggccgaaggcttcattccccgggatatgccg
aagttaccaccgcagacccggcacgctgatgataatgagggagcagggggcggtgccgga
gcagcctctgaaacaggcgacaatgatggtgatcctcgccggatgaggaatgcgcacgat
cgcaccgacagcgctgaaaagaaagctgaccaagaagagaaaaaggaacctcgccggacc
cgtcgcagcaacaaggtcgagcaggctcgaccggatcagacaaggaaggctcgcgatccg
aatgcgccagggaaaagggcgacatcggaccctcagcggccggctcaatccgaactccct
ctgtcttcgaaagctgaggagcaccgcggcatggagcaacgggctgtgccttccgccaga
tccgatattcccgatcccgcagcgcatcagcgagcacaggtcgcgcgcggcaaggccgac
cagaggctccaggaagagcagcagaagtcgctgcttggcggtgcagcgaagcagggtcgc
gatgccgatcaggggcaggaccatggtcacgattacggggacttcgatccggacatgtga

DBGET integrated database retrieval system