KEGG   Erythrobacter litoralis HTCC2594: ELI_04315
Entry
ELI_04315         CDS       T00315                                 
Name
(GenBank) hypothetical protein
  KO
K12061  conjugal transfer pilus assembly protein TraW
Organism
eli  Erythrobacter litoralis HTCC2594
Brite
KEGG Orthology (KO) [BR:eli00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eli02044]
    ELI_04315
Secretion system [BR:eli02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ELI_04315
SSDB
Other DBs
NCBI-ProteinID: ABC62955
UniProt: Q2NBI6
Position
complement(894921..895553)
AA seq 210 aa
MRSFLPIGALLLAMLPASLQARDYGQRGAVFPVIERDLLEQIHTRLAQMEKSGETARLNE
ELKRRTIARVNRPDPVAGLIRASASRSWAFDPTIALAADIRGAKGELIHAAGTRVNPLDS
VKLRSDLLFLDGDDPAQIAWALRQDANAKLILVKGAPLELMKARQRRFYFDQGGKLTQKF
GIKAVPARVRQNGRFLEVSEIALPRRKAQP
NT seq 633 nt   +upstreamnt  +downstreamnt
atgcgctctttccttccgattggcgcgcttctcctcgccatgctccctgccagcctgcag
gcacgagactacggccagcgcggcgcggtcttccctgtgatcgagcgcgacctgctcgaa
cagattcatacgcgcctcgcgcagatggaaaagtcgggcgagaccgcgcggctcaacgag
gaactcaagcgtcgcacgatcgcacgcgtcaaccgacccgatccggttgccggcctcatt
cgcgcaagcgcaagccgcagctgggcgttcgatccgacaatcgcgcttgctgccgatatc
cggggcgcaaaaggcgagctgatccatgccgccggaacccgggtcaatccgctcgacagc
gtcaagctgcgctccgacctcctgtttctcgacggcgacgaccctgcgcagatcgcctgg
gcgctgaggcaggacgccaatgccaagctgatcctcgtgaaaggcgcaccgctcgagctg
atgaaggcccgtcaacgccgcttctatttcgaccagggcggcaagctgacgcaaaaattc
ggtatcaaggctgttcccgcgcgggtgcgccagaacgggcgcttcctcgaagtcagcgag
attgcgctgccgcgccggaaggcacagccatga

DBGET integrated database retrieval system