KEGG   Erythrobacter litoralis HTCC2594: ELI_04335
Entry
ELI_04335         CDS       T00315                                 
Name
(GenBank) hypothetical protein
  KO
K12063  conjugal transfer ATP-binding protein TraC
Organism
eli  Erythrobacter litoralis HTCC2594
Brite
KEGG Orthology (KO) [BR:eli00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eli02044]
    ELI_04335
Secretion system [BR:eli02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ELI_04335
SSDB
Motif
Pfam: DUF5934 TraC_F_IV P-loop_TraG AAA_10 TrwB_AAD_bind CbiA AAA_22 RNA_helicase TraG-D_C Mg_chelatase MeaB AAA_16 T4SS-DNA_transf FtsK_SpoIIIE MobB AAA_23 Fer4_NifH DUF87 ABC_tran AAA_33 NACHT AAA_18 PRK AAA_29 AAA_30 PIF1 KTI12 AAA_24
Other DBs
NCBI-ProteinID: ABC62959
UniProt: Q2NBI2
Position
complement(896833..899382)
AA seq 849 aa
MNLSLSSARDALLAGLFGDAKKADHAQPRFALDMLSDWLPYRIYDEGPGLYRNAHSKGFI
LEVTPLIGADERTGEILGQFFSESLPQGACLQVLNFASPRIGAIVGPWFAPRYEQGGIYE
AIAKARTNRLYDLVWKSGSAHAPFHARHVRLVLSLGVPVPGNVTDAELTECRDGMAGMLN
SLGLASNRLEPAGLLALVDELTSPTTAREPDLTHWNREDTLDAQAIRRDIELEVEDDRLI
LRTERFRETGRSRDGVPQVGECYPDRFDVRHYGVRSTPERWAPWECARLIGDMFTDKLRF
PCPAATMLCLHYPDQEAASARAGYKFMRTTSLSETKSARFLPRLGEQSAEWRHVQAELQA
GKKLVKLFYGLTTISPLGEGDAHERTVKAIYKAAGWDLADERFLQLQGLVASFPLSLADG
LVHDLARLKRFRTMLSTTAANIAPLQGEYLGGTIPHLLLLGRRGQPFFWSPFENAAGNHN
IAICGKSGSGKSVLLQELCAALRGAGAKVVVIDDGRSFEHSVKLQGGRFVEFTLASGFSL
NPFSMVDDARAHEDEDYRLDCFAMIKAIVGQMARPSAAPSDTERGLIDRAVTQVWEALGS
GGAIDDVAHALHQSENEAGKDLATAIAPFCRGGSYAGFFSGKASFALEDDFTVFEMSDLA
SREELRSVVLSAIMFMTGQAMTRSSRSTKKLLLIDEAWAMLKGGSMGEFVETYARTARKY
GGALATATQSLNDYYKSDGARAALENSDWMLVLQQKPETIADFRKEARLDMDDRTETLIR
SLKRSGTEYSEIYLKGPEMEAVGRLVLDPLSATIFSSDPDTYAAIRRHVENGMPLERAVA
LVAGVEGGA
NT seq 2550 nt   +upstreamnt  +downstreamnt
gtgaacctctcgctatcctctgcgcgcgacgcgctcctcgctggcctgttcggcgatgcg
aagaaagccgaccatgcgcagccgcgtttcgcgctcgacatgctgtcggactggcttccg
taccgcatctatgacgagggcccggggctctaccggaacgcgcactcgaagggcttcatt
ctcgaagtcaccccgctcatcggcgccgatgagcgcaccggtgaaatcctcgggcagttc
ttctccgagagcctgccgcaaggcgcctgtttgcaggtgctgaacttcgcgtctccgcgc
atcggcgccatcgtcggcccctggttcgcgccgcgctacgagcagggcgggatctacgaa
gcgatcgcgaaggcccgcaccaaccggctctacgatctcgtctggaagtcgggctcggca
cacgcgccgtttcatgcgcgccatgtgcgtctcgtgctgtcgctgggcgttccggtgccc
ggaaacgtgaccgatgcagaactcaccgaatgccgcgacgggatggcggggatgctgaac
tcgctcggccttgcatcgaacaggctcgagcccgcaggcctgctcgcactggtcgacgaa
ctcacctcgccgacgacagcgcgcgaacccgatctcacccactggaaccgcgaggacacg
ctcgacgcgcaggccatccgccgcgatatcgaactcgaggtcgaggacgaccggcttatc
ttgcgcaccgagcgcttccgcgagaccgggcgctcgcgagatggcgtgcctcaggtaggt
gaatgctatcccgaccgcttcgatgtgcgccattacggcgtgcgctctacccctgagcgc
tgggcaccgtgggaatgcgcgcggctcatcggcgacatgtttactgacaagctgcgcttt
ccctgtcccgccgcgacaatgctgtgcctgcactatcccgaccaggaggccgcctcggcg
cgcgccggctacaagttcatgcgcaccaccagcctttcggaaacgaagagcgcgcgcttc
ctccctaggcttggcgagcaatcggccgaatggagacacgtccaggccgaactccaggcg
ggcaagaagctcgtcaagctgttctatggtctcaccacgatctcgccgctcggcgaaggc
gatgcgcatgagcgcacggtcaaggcgatctacaaggcggccggatgggaccttgccgac
gagcgcttcctccagctccagggcctcgtcgcctcgttcccgttgagcctcgccgatggt
ctggtccacgaccttgcgcggctcaaacgcttccggaccatgctctcgaccaccgcggcc
aatatcgcccccctgcagggcgagtatctcggcgggacgatcccgcacctgctgctcctc
ggacggcgcggccagcccttcttctggtcgcccttcgagaacgcggcgggcaaccacaac
atcgcgatctgcggaaagtcgggctcgggcaagtcggtgctgctgcaggagctgtgcgcc
gcgctgcgcggcgcgggcgccaaggtcgtggtgatcgacgacggacgcagttttgagcat
tcggtcaagttacagggcggccgcttcgtcgagttcacgctcgcctcgggattctcgctc
aaccccttctcgatggtcgacgatgcgcgcgcgcatgaagacgaggattaccggctcgac
tgcttcgccatgatcaaggccatcgttggccagatggcgcggccaagcgccgcgccttcg
gacacggagcgcgggctgatcgaccgcgcggtgacgcaggtgtgggaagcgctcggcagc
ggcggggcgatcgacgacgtcgcgcatgcgctccatcagagcgagaacgaggcgggcaag
gatctcgccacagcgatcgcgcccttctgccgcggtggcagctatgccgggttcttctcg
gggaaagcgagtttcgcgctcgaagacgatttcaccgtcttcgagatgagcgacctcgcg
tcccgcgaggagcttcgaagcgttgtcctctcggcaatcatgttcatgaccggtcaggcg
atgacgcgctcgtcgcgctcgaccaagaagctgctgctgatcgacgaggcctgggcgatg
ctcaagggcggttcgatgggcgagttcgtcgagacctatgcccgcaccgcgcgcaaatat
ggcggcgcgcttgcgaccgcgacccagtccttgaacgactactacaagtccgatggtgcg
cgcgccgcgctcgaaaacagcgactggatgctggtgctccaacagaagcccgagaccatc
gccgatttccgcaaggaggcccggctcgacatggacgaccggaccgagacgctgatccgc
agcctcaagcgctcgggcaccgagtacagcgagatctacctcaaaggtcccgagatggaa
gccgttggacgcctggtgctcgacccactctcggcaaccatcttctcctccgatcctgac
acctatgccgcgatccgccgccatgtcgaaaacggcatgccgctcgagcgcgcagtcgcg
ctggtcgcaggtgtggaaggaggcgcatga

DBGET integrated database retrieval system