KEGG   Erythrobacter litoralis HTCC2594: ELI_04660Help
Entry
ELI_04660         CDS       T00315                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00010  Glycolysis / Gluconeogenesis
eli00620  Pyruvate metabolism
eli00640  Propanoate metabolism
eli00680  Methane metabolism
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01120  Microbial metabolism in diverse environments
eli01130  Biosynthesis of antibiotics
eli01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELI_04660
   00620 Pyruvate metabolism
    ELI_04660
   00640 Propanoate metabolism
    ELI_04660
  Energy metabolism
   00680 Methane metabolism
    ELI_04660
Enzymes [BR:eli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ELI_04660
Lipid biosynthesis proteins [BR:eli01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ELI_04660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABC63024
UniProt: Q2NBB7
Position
complement(962638..964578)
Genome map
AA seq 646 aa AA seqDB search
MSDQSEWVQRPASALKGTNCTAEQYEKMYASSLQDSDAFWAKQAERIDWFQKPSKIANWS
FDPVDIKWFEDGTLNICHNAVDRHVEAGNGDRTAIIFEPDSPDGEVRTFSYADVQREVIR
MANTLKKLGVAKGDRVTIYMPMVPEGAFAMLACARIGAIHSVIFGGFSPDAIAGRVDDCE
SDWIVTADEGLRGSKTIPLKANVDSALEKVSAKGVLVLRHTGGDVSMTDGRDHWYHELSA
EVSDECLCEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYAVWTETTFRYIFDYRDGEVFW
CTADIGWVTGHSYIVYGPLQNGATALMFEGVPNYPDHDRFWQVCAKHKVNIFYTAPTAIR
ALMREGDHHVEKHDLSSLRLLGSVGEPINPEAWRWYHETVGKERIPIIDTWWQTETGGCM
ITTLPAAHDMKPGSAGKPFFGVQPQLVDNEGAELEGAASGNLCITHSWPGQARTVYGDHE
RFIQTYFSTYPGKYFTGDGCRRDEDGYYWITGRVDDVINVSGHRMGTAEVESALVLHPKV
SEAAVVGFPHDIKGQGIYCYVTLMDGVEESDELSAELRQWVRKEIGPIATPDHLHFTPAL
PKTRSGKIMRRILRKIGENEFGSLGDTSTLADPGVVDALIEGRKNR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcaatccgagtgggtacagcggccagcgagcgcgctgaagggcaccaattgc
acggccgagcaatatgagaaaatgtatgccagcagcctgcaggacagtgatgccttctgg
gccaagcaggccgagcggatcgactggttccagaagccgtcgaagattgccaactggagc
ttcgaccccgtcgatatcaagtggttcgaagacggcacgctcaacatttgccacaacgcc
gtcgataggcatgtcgaggccggcaatggggatcggacagcgatcatcttcgagccagac
tcgcccgatggcgaagtgcgcacgttcagctacgcggatgtccagcgcgaagtcatccgc
atggccaacacgctcaagaaactcggcgtcgccaagggcgatcgcgtcacgatctacatg
ccgatggtgcccgaaggcgccttcgcgatgcttgcctgcgcgcggatcggggcgatccac
tcggtgatcttcggtggcttctctcccgatgccatcgccggacgggtggacgactgcgag
agcgactggatcgtcactgccgacgagggcctgcgcgggtcgaagactatcccgctcaag
gccaatgtcgattcggcgctggaaaaagtctccgccaagggcgtgctggtgctgcgtcat
accggcggcgacgtgtcgatgaccgatggccgcgaccattggtatcacgagctgtccgca
gaggtgtccgatgaatgcctgtgcgagccgatgaacgccgaggatccgctcttcatcctc
tatacctcaggctcgaccggcaaacccaagggcgtgctgcacaccaccgggggctatgcc
gtctggaccgagaccaccttccgctacatcttcgactaccgcgacggcgaggtgttctgg
tgcaccgccgatatcggctgggtcaccgggcacagttatatcgtttacggccccctgcag
aacggcgcgactgcgctgatgttcgaaggcgtgccgaactaccccgatcacgaccgcttc
tggcaggtttgcgccaagcacaaggtcaatatcttctacaccgccccgaccgcgatccgc
gcgctgatgcgcgaaggcgaccatcacgtcgagaagcacgacctctcatcattgcgcctg
ctcggcagcgtcggcgaaccaatcaatcccgaggcctggcgctggtatcacgagaccgtc
ggcaaagagagaattcccatcatcgatacgtggtggcagaccgaaaccggcggctgcatg
atcaccaccctgcccgccgcgcacgatatgaagccgggaagcgcaggcaagccattcttc
ggcgtccagccgcaactggtcgacaacgaaggtgctgagctggagggcgcggccagcggg
aacctgtgcatcacgcatagctggcccggccaggcgcgcacggtctatggcgatcacgag
cgcttcatccagacctatttcagcacctacccgggcaagtacttcaccggcgacggctgc
cgacgcgacgaggacggctattattggatcaccggccgcgtcgacgatgttatcaacgtc
tccggccaccgcatgggcaccgccgaagtcgaaagcgcgcttgtgctgcatccgaaggtc
agcgaagcggcggtcgtcggcttcccgcacgatatcaagggccagggcatctattgctac
gtcaccctgatggacggagtcgaggaaagcgacgagctgagcgccgaactgcgccagtgg
gtgcgcaaggaaatcggcccgatcgcgacgccagaccacttgcatttcacgcccgccctg
cccaagacccgcagcggcaagatcatgcgccgcatcctgcgcaagatcggcgagaacgaa
ttcggatcgctcggcgacacttcgacgctggcggatccgggtgtcgtcgatgcgctgatc
gaggggcggaagaaccggtag

DBGET integrated database retrieval system