KEGG   Erythrobacter litoralis HTCC2594: ELI_04920Help
Entry
ELI_04920         CDS       T00315                                 

Definition
(GenBank) biotin synthase
  KO
K01012  biotin synthase [EC:2.8.1.6]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00780  Biotin metabolism
eli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eli00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ELI_04920
Enzymes [BR:eli01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.6  biotin synthase
     ELI_04920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BATS Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ABC63076
UniProt: Q2NB65
Position
1015230..1016255
Genome map
AA seq 341 aa AA seqDB search
MTPIRTNWSRDEIAALFEQPFTELLFQAATVHRAYHPPEQVQLCTLLSIKTGGCPEDCGY
CSQSVKADSGVEATKLMDVQRVLQSAAQAKDAGSQRFCMGAAWRNPKDRDMPAIVEIVKG
VRDMGLETCMTLGMLTPKQADMLKDAGLDYYNHNVDTGPEYYERVISTRNYQDRLDTLQN
VRDAGINVCSGGIVGMGETREDRVGFVHTLATLERHPESVPVNALVPVKGTVLGDMLADT
PLAKIDDIEFVRTVAVARITMPLSMVRLSAGRESMSEATQALCFMAGANSIFTGDKLLTA
ANAGDDKDAALFDKLGLTALQGEEPLRRAKDEAGKAAIPAE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacccccatccgtaccaattggagccgtgacgaaatcgcggccctgttcgaacaaccg
ttcaccgagctgctattccaggccgccacggtccaccgcgcctaccatccgcccgagcag
gtgcagctctgcacactgctgtcgatcaagaccggcgggtgcccggaggattgcggctat
tgttcgcagtcggtgaaggccgatagcggcgtcgaagcgaccaagctgatggacgtccag
cgcgtgctgcaatcggcggcgcaggccaaggatgcgggctcgcagcgcttctgcatgggc
gcggcgtggcgcaatcccaaggaccgcgacatgcccgcgatcgtcgagatcgtgaagggc
gtgcgcgacatggggctggagacctgcatgacgctgggcatgctgacgccgaagcaggcg
gacatgctcaaggacgcgggcctcgattactacaaccacaacgtcgacaccgggccggaa
tattacgagcgcgtaatctcgacccgcaattaccaggaccgtctcgacacgctccagaac
gtccgcgatgccgggatcaacgtgtgcagcggcgggatcgtcggcatgggcgaaacgcgc
gaggaccgcgtgggcttcgtccacacgctcgccacgctcgaacgccatccagaaagcgtg
ccggtcaatgcgttggtgccggtcaagggcacggtgctcggcgacatgctggccgacacg
ccgctcgccaagatcgacgatatcgaattcgtccgcaccgtggcagtggcgcgcatcacc
atgccgctgagcatggtgcggctgtccgcaggacgcgagagcatgagcgaagcgacgcag
gcgctgtgtttcatggcgggcgcgaactcgatcttcaccggcgacaagctgctgacggca
gccaatgccggcgatgacaaggacgcggcgctgttcgacaagctcgggttaacagccttg
caaggtgaagaacccttgcgacgcgccaaagatgaagcagggaaggcggcgattcccgcg
gagtga

DBGET integrated database retrieval system