KEGG   Erythrobacter litoralis HTCC2594: ELI_06130Help
Entry
ELI_06130         CDS       T00315                                 

Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00010  Glycolysis / Gluconeogenesis
eli00020  Citrate cycle (TCA cycle)
eli00620  Pyruvate metabolism
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01120  Microbial metabolism in diverse environments
eli01130  Biosynthesis of antibiotics
eli01200  Carbon metabolism
Module
eli_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELI_06130
   00020 Citrate cycle (TCA cycle)
    ELI_06130
   00620 Pyruvate metabolism
    ELI_06130
Enzymes [BR:eli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ELI_06130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF4358
Motif
Other DBs
NCBI-ProteinID: ABC63318
UniProt: Q2NAH3
Position
1270110..1271423
Genome map
AA seq 437 aa AA seqDB search
MPTPIKMPALSPTMEEGTLAKWLVKVGDTIGAGDIMAEIETDKATMEFEAVDEGTVAEIL
IDEGSENVKVGEVIMILAEEGEDIEEAKAAAPQKSDATSETVRAEPVEALSSTSAPPATK
KDDPSTGSGRTESGGSASSSGDRIIASPLAKRIAEQKGLDLSTVTGSGPNGRIIKADVEG
AEAGEAPDKADAPAPAQAKQPSLGGDLDAPYEAEKLNNVRKVIARRLTEAKQTIPHIYLT
VDVRLDALLDLRKQLNASLEADGVKLSVNDLLIKALARALQRVPKCNVSFQGDELYQYTR
EDISVAVAAPSGLITPIIRDAGRKGLAQISTEMKELAGKAKDGKLQPQEYQGGTASLSNL
GMFGTKQFDAVINPPQAMILAVGAGEQRPHVIDGALGVAMVMSATGSFDHRAIDGADGAQ
LMEAFQQLCENPMGLVV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgccgacaccgatcaagatgcccgcgctttcgccgacgatggaggaaggcacgctcgcc
aaatggctggtcaaggtcggcgatacaatcggtgcgggcgacatcatggccgagatcgaa
accgacaaggccacgatggagttcgaggctgtcgacgaaggtactgtagccgaaatcctg
atcgacgaaggcagcgagaacgtgaaggtcggcgaggtcatcatgatcctcgcggaagag
ggcgaggacatcgaggaggccaaggcggcggcaccgcaaaagtccgatgcgacctcagag
accgttcgggctgagccagtcgaggccctgtcctccacttccgccccgcctgcaacgaaa
aaggacgacccttcgacaggctcagggcgaacggaaagtggcgggtctgccagttcctcg
ggcgatcgcatcatcgcctcaccgctggccaagcggattgccgagcagaaaggtctcgat
ctttcgaccgtcaccggcagcggcccgaatggccggatcatcaaagccgatgtcgaagga
gcggaagcgggcgaggctcccgacaaggctgatgctccggctccagcacaggccaagcaa
ccgtccctgggcggcgatctcgatgcgccctacgaggccgaaaagctcaacaacgtccgc
aaggtcattgcgcgccgcctgaccgaagcgaagcagaccattccgcatatctacttgacc
gtggacgtgcggctggatgcgctgctggacctgcgcaagcagttgaacgcctcactcgaa
gccgatggggtcaagctctcagtcaacgacctgctgatcaaagcgctcgctcgcgcgctc
cagcgcgtgcccaagtgcaacgtcagcttccagggcgacgagctctatcaatacacccgc
gaggacatctccgtggcggtggccgcgccttctggtctcatcacgccgatcatccgcgat
gccggtcgcaagggcctcgcgcagatcagtaccgaaatgaaagaactcgccggcaaggcg
aaggacggcaagctgcagccgcaggaataccagggcggcaccgcctcgctgtccaatctc
ggcatgttcggcaccaagcagttcgatgcagtgatcaatccgccacaggccatgatcctc
gccgtgggcgcaggcgagcagcgcccgcatgtcatcgacggcgcactcggcgtcgccatg
gtgatgagcgccaccggcagcttcgaccaccgcgccatcgacggcgcagacggcgcgcaa
ctgatggaggcgttccagcagctgtgcgagaacccgatggggctggtggtttaa

DBGET integrated database retrieval system