KEGG   Erythrobacter litoralis HTCC2594: ELI_06515Help
Entry
ELI_06515         CDS       T00315                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01130  Biosynthesis of antibiotics
eli01230  Biosynthesis of amino acids
Module
eli_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ELI_06515
Enzymes [BR:eli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ELI_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABC63395
UniProt: Q2NA96
Position
1351251..1352036
Genome map
AA seq 261 aa AA seqDB search
MNKLEEICAAKLDEVATRKAALSDSELADRIAAQSAPRGFEAALRAKAVTDFALIAEIKK
ASPSKGLIRADFHPADHARAYEAGGAACLSVLTDEDYFQGHADYLREARDACTLPALRKD
FMVDPWQCAEARSMGADAILIIVAALSNAQMHEIEAAALEHRMDALVEVHDEEEMSRAHA
LQSRLVGVNNRDLKTFTTDLATTERLAPLAPAGALLVGESGIDNHADCVRLSQAGVQTFL
VGESLMRQDDVEAATRELLGG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacttgaagagatatgcgccgccaagctcgacgaagtcgcgacgcgcaaggct
gcgctgtcggatagcgaattggccgatcgcatcgcagcccaatccgcgccgcgcgggttc
gaagccgctctgcgtgccaaggccgtaaccgacttcgcactgattgccgagatcaagaaa
gcctcaccgtcgaagggtctcatccgcgcagactttcatcccgcagaccacgcccgcgcc
tatgaggcaggcggcgcggcgtgcctgtccgtcctgaccgatgaagactatttccagggc
cacgccgattacctgcgcgaagcgcgcgatgcgtgcaccctccccgccctgcgcaaggac
ttcatggtcgatccgtggcaatgcgccgaagcccggagcatgggtgccgacgcgatcctg
attatcgttgcggcactctccaatgcgcagatgcacgagatcgaagctgctgcgctggag
catcggatggatgcgctggtcgaagtgcacgacgaagaagaaatgagtcgcgcccatgcg
ctgcaatcgcggctggttggcgtcaataatcgcgacttgaaaaccttcaccaccgatctc
gcgaccaccgagcgcttggctccgctggcacccgcaggcgcgcttctggtcggagaaagc
ggtatcgacaaccacgccgattgcgtgcggctgtcgcaagcgggggtccagaccttcctc
gttggtgagagcctgatgcggcaggacgacgtcgaagccgccacccgcgaacttctcggc
ggttag

DBGET integrated database retrieval system