KEGG   Erythrobacter litoralis HTCC2594: ELI_09625Help
Entry
ELI_09625         CDS       T00315                                 

Definition
(GenBank) Zinc-containing alcohol dehydrogenase superfamily protein
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00010  Glycolysis / Gluconeogenesis
eli00071  Fatty acid degradation
eli00350  Tyrosine metabolism
eli00625  Chloroalkane and chloroalkene degradation
eli00626  Naphthalene degradation
eli00680  Methane metabolism
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01120  Microbial metabolism in diverse environments
eli01130  Biosynthesis of antibiotics
eli01200  Carbon metabolism
eli01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELI_09625
  09102 Energy metabolism
   00680 Methane metabolism
    ELI_09625
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ELI_09625
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ELI_09625
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ELI_09625
   00626 Naphthalene degradation
    ELI_09625
Enzymes [BR:eli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ELI_09625
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     ELI_09625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABC64017
UniProt: Q2N8H4
Position
1961788..1962876
Genome map
AA seq 362 aa AA seqDB search
MAKAAILEKPGEGLVIGDVEIADPAPHEVLIDTKACGLCHSDLHFIDGAYPHPLPAIPGH
EAAGVVRAVGSEVKTVRPGDHVVSCLSAFCGHCEFCVTGRMALCMGADTRRGPDGPPRIT
RADGSPINQMLNLSAFSEQMLIHEHACVAIDKDMPLDRAAVIGCAVTTGAGTIFNAANVT
PGETVLVVGCGGVGLAAINAAKIAGAGKVIAADPLEEKRELAKVLGATHTVNALDEDAAQ
QILTISAGGVHYGIEAVGRQASADLAVASLRRGGTAIILGMMPLDCKVGLGAMDLLSGKK
LQGAIMGENHFPVDLPRLVDFYMRGLLDLDTIIAERISLDEINAGFDKMREGHSARSVVV
FD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggccgcaattttagagaaacccggcgaagggctggtcatcggcgatgtcgaa
attgccgatccggcaccgcatgaggtcctgatcgacaccaaggcgtgcgggctgtgtcat
tcggacctgcacttcatcgacggggcttatccgcacccgctgcccgccatcccggggcac
gaggcggctggtgtggtgcgcgcggtcggcagcgaagtgaagacggtgcggccgggcgac
catgtggtgtcctgcctcagcgccttctgcggccattgcgagttttgcgtcaccggccgg
atggcgctgtgcatgggcgcggacacgcgccgtggaccggacggcccgccccgcatcacc
cgggccgatggctctcccatcaaccagatgctgaacctgtcggcattctccgagcagatg
ctgatccacgaacacgcctgcgtcgctatcgacaaggacatgccgctggaccgcgctgcc
gtgatcggctgcgccgtcacgactggtgccggcacgatcttcaacgccgccaatgtcacg
ccgggcgagacagtgctggtggtcggctgcggcggtgtcggtctcgcagccatcaatgcc
gccaagattgccggggctggcaaggtcatcgcagccgatccgctcgaggaaaagcgcgaa
ctcgcgaaagttctcggcgcgacccacacggtcaacgccctcgacgaggacgcagcgcag
cagatcctgacgatttcggccgggggcgtgcattatgggatcgaggcggtgggccgccag
gcctccgccgacctcgcggtcgcttcgctgcggcgcggcgggacggcgatcatcctcggc
atgatgccgctcgactgcaaggtcggcctcggcgcgatggacctgctgtcgggcaagaag
ctgcaaggcgcgatcatgggcgagaaccactttcccgtcgatctcccgcgactggtcgac
ttctacatgcgcggtttgctcgatctcgacacgatcatcgccgaacgcatctcgctcgac
gagatcaatgccgggttcgacaagatgcgagagggtcattccgctcgcagcgtagtggtg
ttcgactga

DBGET integrated database retrieval system